KEGG   Marinomonas sp. MWYL1: Mmwyl1_1189
Entry
Mmwyl1_1189       CDS       T00567                                 

Definition
(GenBank) VgrG protein
Organism
mmw  Marinomonas sp. MWYL1
SSDB
Motif
Pfam: DUF2345
Other DBs
NCBI-ProteinID: ABR70118
UniProt: A6VUI9
Position
1326658..1327251
AA seq 197 aa
METDVLNDRITHIGHDQHGQIDNDRLTQIGGDNGTGNDHLTIKGESRHKIDKDQSISIDG
NLQQKVGKIAVLEAGEEIHIKSGDKTVIEAGAEITLAAGGSFVKIDGGGVHLVGSVINLN
SGGSPSAGSGFSGGEPLLPGGILSPVAPEKSLMAPHSPSMKVTLPAVAELDLPVMELCQR
QADGACTKANCTCIQDA
NT seq 594 nt   +upstreamnt  +downstreamnt
atggaaaccgatgtgctcaacgaccgcatcacccacatcggccacgaccaacacggacaa
atcgacaacgaccgcctcacccaaatcggcggagataacggcacaggcaatgaccacctg
accatcaaaggcgagagtcgtcacaagatagataaagatcaatccatcagtattgatggg
aacttacagcaaaaggtcggaaaaattgccgtattagaggcaggtgaagaaatacacatc
aagagtggtgacaaaaccgtgattgaagcaggagcagaaatcacccttgccgcaggcggc
agcttcgtcaaaatcgacggcggcggtgtccacctcgtcggctcggttatcaacttaaat
tctggcggtagcccaagtgcggggagtgggtttagtgggggagagcctctcttacctggt
ggtatcctttctcctgtcgctccagagaagtcgcttatggctccacatagcccgagcatg
aaggtaacgcttcctgctgttgctgagttggatttacctgttatggagctttgtcagaga
caggctgatggagcctgcacaaaagcaaattgtacatgtattcaggatgcataa

DBGET integrated database retrieval system