KEGG   Marinomonas sp. MWYL1: Mmwyl1_1195
Entry
Mmwyl1_1195       CDS       T00567                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mmwyl1_1195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1195
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mmwyl1_1195
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABR70124
UniProt: A6VUJ5
Position
complement(1335440..1335958)
AA seq 172 aa
MPTPCFISIEGESQGLITAGAMTVDSIGDVGLEGHDDEMLVQRFDHNVTVPTNPQSGNPS
GQRVHKPFKFTVALNKAVPLLYNALSSGEKLPKVELKWYRTSAEGKQENFFVTELEGAVI
VDIHCEMPHCQDPAMGNFTQNLTVSMAYRKITWDHINSGTSGSDDWSKPIEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaacgccatgttttatctcgatcgaaggggaatctcagggtcttatcactgctggt
gccatgacagtcgattctatcggtgacgtaggcttggaaggtcatgatgacgaaatgctg
gtgcaacgctttgaccacaacgtcactgtaccgactaacccacagtctggtaacccatct
ggtcaacgcgtacacaagccattcaaattcaccgttgctttgaacaaagcggttccattg
ctttacaacgcactgtcttctggcgaaaaattgccaaaagtggaattgaaatggtaccgc
acgtctgcagaaggcaagcaagagaacttcttcgttaccgaactagaaggcgcggtcatc
gtagacatccattgcgaaatgccacattgccaagacccagcgatgggcaacttcacacag
aacctaacggtctctatggcttaccgtaagatcacttgggatcacatcaactctggtacg
tctggttctgacgactggagcaagccaatcgaagcgtaa

DBGET integrated database retrieval system