KEGG   Marinomonas sp. MWYL1: Mmwyl1_1196
Entry
Mmwyl1_1196       CDS       T00567                                 

Definition
(GenBank) uncharacterised conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
mmw  Marinomonas sp. MWYL1
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1196
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mmwyl1_1196
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABR70125
UniProt: A6VUJ6
Position
1336721..1337221
AA seq 166 aa
MSKEGSVAPKERINIKYIPATGDSQSEVELPLKTLVVGDFKGHAEDTPLEDRKSISIDKA
NFESVMRESNLRLQTTVSNKLDEESDGDLTVDLSFSGINDFSPDSIASQVPELKKLIELR
EALVALKGPLGNIPSFRNSLQGLLASDESRDQLLAELNLAHGNESN
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcaaaagagggaagtgtcgcacccaaagagcggataaatattaaatatatacctgct
actggagattctcagtctgaggttgagttgcctctaaaaaccttggttgttggtgacttt
aaaggtcatgcagaggatacgcctttagaagatagaaagagcatttctatagataaagct
aattttgagtctgtaatgcgtgaaagtaatttgcgtcttcagacgacagttagtaataag
ctagatgaggagtctgatggtgatttaacagtagatctttcttttagtgggattaatgat
ttttcaccagattcaattgcatcgcaagttccagagcttaaaaaattaatagagctaaga
gaagctttagtagcgttaaaaggtccattgggtaatatcccttctttcagaaatagtttg
caaggcttgttagcatcagatgaaagtcgtgatcagctattggctgaattaaatctagct
catgggaatgagtcaaattaa

DBGET integrated database retrieval system