KEGG   Marinomonas sp. MWYL1: Mmwyl1_1198
Entry
Mmwyl1_1198       CDS       T00567                                 

Definition
(GenBank) GPW/gp25 family protein
  KO
K11905  type VI secretion system protein
Organism
mmw  Marinomonas sp. MWYL1
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1198
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mmwyl1_1198
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ABR70127
UniProt: A6VUJ8
Position
1338761..1339198
AA seq 145 aa
MSYLIDENSVFGVSFMERLNVNAKAISLSQGPDSIDVLNSIKLNVANVLNTRLGEAQSAP
NLGLIDFNDASLGAMDLSLKVKLAVQKCLATYEPRLCNLQIKTVTDPNNPLGLCFHINAD
INSAALHEKVEINLILGNDRKYRVY
NT seq 438 nt   +upstreamnt  +downstreamnt
atgagctacctaatagatgaaaatagtgtttttggcgttagcttcatggaacgattgaat
gttaatgctaaggctatctctttgtctcaggggccagattctatagatgttcttaactca
ataaagctgaatgtagccaacgttctgaatactagattgggggaggcgcaatccgcccct
aatctaggattgatagattttaatgacgcttcgttgggcgccatggatctatctttaaaa
gtgaagttggctgtgcagaaatgtttagcgacttatgagcctagattatgcaacttacaa
atcaaaacggttacagatccaaataaccctttaggtttgtgttttcatatcaatgctgac
atcaatagtgctgcgcttcatgagaaagtagagattaatttaatacttggtaatgaccgt
aaatatagagtgtattag

DBGET integrated database retrieval system