KEGG   Marinomonas sp. MWYL1: Mmwyl1_1199
Entry
Mmwyl1_1199       CDS       T00567                                 

Definition
(GenBank) protein of unknown function DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
mmw  Marinomonas sp. MWYL1
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1199
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mmwyl1_1199
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABR70128
UniProt: A6VUJ9
Position
1339201..1340967
AA seq 588 aa
MSQDKYFREELAFLREQGKQFTEIHPQLSRFLHGRNTDPDVERLLEGFAFLTGRLREKIE
DEFPELTHSIINMLWPNYLRPVPSMSVVKFKPEDNVSTKHVIQSGVQLDSRPVFGTTCHF
RTCRDVSIYPLDCVDVSAQHTREASTVNLAMKIDGDLTLDDIKLDTLRFYLGGDKFSAEM
TYLWLNHYLEKIVIEVGGVEFKLPKDTLSLVGFEAADSLLPYPKNVYDGYRILQEYLTFS
ESFNFFDLKGLSSALPKNISGEFTIKMVFNKTFEPGVKVRKEMFQLYCTLVVNLFEHDAD
PIDLTGRKTEYRIIPSSTSPSHYEVFSIDEVAGWQNSSNGGRARGAKRVYSSFESFQHEV
ERARHRESLYYRARVKDSIRNDGFDNFISFVRGDESSVYNFDEAVSLKLTCTNRQLPLEL
GIGDICEPTDTSPTFATFENITIPSPPLRPVLDGSLLWTLISNLSLNYLSLLSKDALCSV
LRAYDFKALVDRQAERVSRLRLSGILKIESMPTDKLIQGMPIRGLKSTITLDQAAFGSEG
ELFLFGTVLSKFFSLYASINSFHELVVINSSNKEAYTWGIQEGMQPLI
NT seq 1767 nt   +upstreamnt  +downstreamnt
gtgagccaagataagtattttagagaagagctggcgtttttacgtgagcaaggaaagcaa
tttacggaaattcatcctcagctttctcgtttcttgcatgggcgaaatacggaccctgat
gttgagcgattgttagaggggtttgcttttctaaccgggcgtttaagggaaaaaattgaa
gatgagttccctgagttaactcattcaatcattaatatgctttggcctaattatctgcga
ccagtgccaagtatgagtgttgttaagtttaagccagaggataacgtgagcactaagcac
gttattcagtctggtgttcaacttgatagtcgtccagtttttggtactacatgtcatttt
agaacctgccgcgacgtctctatttaccctttagattgtgtagacgtttctgcgcaacat
acaagggaggcgagtaccgtaaatcttgcaatgaaaattgacggagatttaacgctcgat
gacatcaagctcgatacattaaggttctatttaggtggtgataaattcagcgctgagatg
acttatttatggctgaatcactatttagaaaaaattgtgatagaggtcggtggtgttgaa
tttaaactgccgaaagatactttatcactggtaggttttgaagctgccgatagtttgctt
ccgtaccccaaaaatgtttatgacggctatcgaattcttcaggaatatttaaccttttca
gaaagcttcaacttctttgatttgaaaggattatctagtgctttacctaaaaatatttct
ggtgaatttactattaaaatggtcttcaacaaaacgttcgagcctggtgtaaaagttagg
aaggaaatgtttcagctgtattgtacactggtcgttaatttgtttgagcatgatgcagac
cctattgatctaacagggcgtaaaacagaatacaggataattccatccagtacctcaccg
tcacattatgaagtctttagtatcgatgaggttgctggttggcaaaatagcagtaatggt
ggtcgtgctagaggtgcgaagcgtgtgtattcctcgtttgaaagttttcagcatgaggtg
gagcgtgctagacatcgtgaatctctttattacagagctcgtgtaaaagacagtattaga
aatgatggttttgataactttatttcttttgtcagaggtgacgagtcgtctgtttataac
tttgatgaagctgtttctcttaagctaacttgtaccaatagacagttgccgcttgagctt
ggtattggcgatatttgtgaacctactgacacgtctccaacgttcgcaacttttgaaaat
ataacgataccatcgcctcctttaaggcctgttttagatggcagcctgctttggaccttg
atttccaatttatcattaaattatctgtcattgctgtctaaagatgctctttgctctgta
ttgcgggcttatgattttaaggcattagtagatcgtcaggctgagcgcgtttctagatta
cggttgagcggcatcctcaaaatagagtcgatgccgacggataaattgatccagggaatg
cccattcgggggttgaaatcaacgataaccttagatcaggctgcttttggttcggaaggt
gaattatttttgtttggcacagtgctgagtaagtttttttctttatacgcaagtatcaat
tcatttcatgaattggtcgtaattaactcaagcaataaagaggcatatacgtggggaatt
caggaagggatgcaaccactgatatag

DBGET integrated database retrieval system