KEGG   Marinomonas sp. MWYL1: Mmwyl1_1201
Entry
Mmwyl1_1201       CDS       T00567                                 

Definition
(GenBank) putative FHA domain containing protein
  KO
K11894  type VI secretion system protein ImpI
Organism
mmw  Marinomonas sp. MWYL1
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1201
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Mmwyl1_1201
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: ABR70130
UniProt: A6VUK1
Position
1341947..1343458
AA seq 503 aa
MDNITQRVANFIVTNVRSLEAGLLAKMSFEDNGGVIGSALDADWHLKDRSQLIKPFHCEI
VLVDDSFCVKDLCGETYVNSSSMPLGVNKLARLNDEDEIKIGEYEIRVFLNRESELKETS
HSLEQFFFTKSNSLIDGSDNEKFDHDIDLEDICENVKELDPIVMLDSNKSLVDEENLIDE
APLVEVAEDFINSEFKYNSKISPKFTVQADTDNDITAAFGLNDIRRGGSLIEKESKTTKL
KKFFSKSIFSSEKEEEKENGKQVMETQPMDDNVLDLLEQEVAKSYTKEDTVKSSSQYKAT
YDNSSFENNHVLGGPLMSGLEVSIGSNSSVEEMQALSAEIGSTLRACVQGLLDLHSQVKD
SRYGMMHRSLQPIEDNPLKLGLSYEETIRTMFDENKSAVHLSATSSVEESLKMIRIHNEA
VQYATNIALGEILQALSPDALLKRFSRYNRDQKNSQDEKSWAWGMYENYYKELTSNRQQG
FEKLFWEIFEQSYDKKLREKHAE
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggataacatcacacaacgagtcgctaattttattgttacgaatgtacggtctcttgag
gctggactgttggcgaaaatgtcttttgaagataacggtggggttataggttctgcttta
gatgcagattggcaccttaaagaccgtagtcaattaattaaaccttttcattgtgaaatt
gttttggtggatgactctttttgcgtaaaagacttatgtggcgaaacctatgttaattca
tccagcatgcctttaggtgttaataaattagctcggctcaatgatgaagatgaaatcaag
attggtgagtatgagatacgagtttttttgaatagagaatcagagttaaaagaaaccagt
cactcacttgaacagtttttttttactaaaagtaatagcttgattgatggaagtgataat
gaaaaatttgatcatgatattgatcttgaagatatttgtgaaaatgttaaagagctagat
cctattgttatgcttgatagtaataaaagcttagttgatgaagagaatttaattgatgaa
gcgcctttggtcgaagtggctgaagactttattaatagcgaatttaaatacaatagtaaa
atatcaccaaagtttactgtgcaggcagatacggataatgatatcaccgctgcttttggt
ttaaatgatatacgacgtggtggctccttaatagaaaaggaaagtaaaactacgaaactg
aagaaatttttttctaaatctattttttctagtgaaaaagaggaagagaaagaaaacggc
aaacaagtaatggagacccagccaatggacgataatgttttagacctgcttgagcaggaa
gtagcaaagtcttatacaaaagaagatacggtaaagtcgagctctcaatacaaagcaacc
tatgataatagctcctttgagaataatcatgtgcttggtgggcctttaatgtctgggctg
gaggtatcgattggaagtaactctagtgtagaagaaatgcaagcattatcggcagagata
ggaagcaccttgcgtgcttgcgttcaaggcttgttagatttgcattcccaagtgaaagac
agtcgctatggcatgatgcacagaagccttcagcctattgaagataacccacttaagctt
ggcctttcctacgaagaaacgattcgaaccatgttcgatgaaaacaaaagtgcagtgcat
ctttcagctacatcttccgttgaagaaagcctgaagatgataagaattcataatgaagca
gtgcaatatgcaaccaatatcgcacttggtgagattttgcaggctttatctccagacgca
ttattaaagcgctttagtcgttataaccgagaccaaaaaaatagtcaggatgaaaagtct
tgggcatggggaatgtacgagaattattacaaggaattaacttcaaatcgccagcaaggg
tttgagaaactattttgggaaatattcgagcagtcttatgataaaaaattgcgtgagaaa
catgcagagtag

DBGET integrated database retrieval system