KEGG   Marinomonas sp. MWYL1: Mmwyl1_1203Help
Entry
Mmwyl1_1203       CDS       T00567                                 

Definition
(GenBank) protein of unknown function DUF876
  KO
K11893  type VI secretion system protein ImpJ
Organism
mmw  Marinomonas sp. MWYL1
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1203
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mmwyl1_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE GMP_synt_C
Motif
Other DBs
NCBI-ProteinID: ABR70132
UniProt: A6VUK3
Position
1343942..1345276
Genome map
AA seq 444 aa AA seqDB search
MISRNRVIWNEGLFIKPQHFQQQQRYNEYSLNERVQSVSSYLYGISHLSINPEYLSFGRI
AIDSAVGVMPDGTVFRIPQDDMLPDALDIDDATLTGQTIYLAIPLKNESLLEIDWPNEKG
TGRYASHRQEVKDTQSVDGDTAVIDLASMRLKLMFEKEDRSAYASIAIAQIREKRQDGSI
VLEPDFIPCHLDVNCNPQLHRCINELSGLMKERAKGIAVRLGASGQGAIADVSDFMLLQA
LNRLQPILQHLVHLKRLHPERLYEALASICGELSTFTDESRLSPDFKGYNHDLPSDSFWQ
VIRYLRQSLSVVLEPRAVSVQLHQRKYGLMVAPIHDTQLIDNADFILAVKANMPLDELRN
LFIQQTKVSSVEKIRDLISHQLPGIPVLPLPVAPRQLPYFSGYTYYQLDKTSEAWRMLEN
SSGFAFHVAGAFEGLDLQFWAIRD
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaggaatagagttatttggaatgaaggactatttattaagccccaacatttt
cagcaacagcaaaggtacaacgagtactctttaaatgaaagagtgcaatctgttagtagc
tatttatatgggatatcccatttatctattaatccagaatatttatcttttggacgaata
gcgattgatagtgctgttggtgtaatgcctgatggtacggtatttcgtattcctcaggac
gacatgcttccagatgctttggatattgatgatgcaactttaacaggtcaaacgatatat
ttggcaataccgttaaaaaatgaatccttgttagaaattgactggcctaatgaaaaaggc
acaggacgatatgctagccatcgtcaagaagtaaaagatactcagtctgtagatggcgat
accgctgttatagacttagcttctatgcgtcttaaattgatgtttgaaaaagaggatcgt
agtgcttacgcctctattgctatcgcccaaatccgagagaagcgtcaggacggtagtatt
gttttggaacctgatttcataccttgccacctagatgttaactgtaatcctcagttacat
cgttgtattaacgagttatcaggtttaatgaaagagcgtgcgaaaggtattgcggttcgt
ttgggagcatcaggccaaggtgctattgctgatgtttctgattttatgttgcttcaagcg
ttaaatagattacagccaattcttcagcatcttgttcacttaaaacgcttgcatccagaa
cgtttatatgaagcgctagcgtctatttgtggtgagttatcaacatttactgatgaaagt
cgcttgtctcctgattttaaaggctataaccatgacttaccaagcgattctttttggcaa
gtgattcgctatctgcgtcagagcttaagtgtggttcttgaaccaagagcggtttcggtt
caattgcatcaacgtaagtacggcctaatggttgcaccaattcatgatactcagttaatt
gataatgcagactttatcttagcggttaaggcgaatatgccattggatgaattgagaaat
ctatttatccagcaaacaaaagtgtcttcagtagaaaagatcagagatcttatttcacat
caattacctggtatacctgttttgcctttacctgtagcaccaagacagttgccatatttc
tctggttatacctattaccaattagataaaacaagtgaggcttggagaatgttagaaaat
tcttctggttttgctttccatgtcgcaggggcgtttgaaggtttagatttacaattttgg
gcgataagggattaa

DBGET integrated database retrieval system