KEGG   Marinomonas sp. MWYL1: Mmwyl1_1204Help
Entry
Mmwyl1_1204       CDS       T00567                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mmwyl1_1204
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1204
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mmwyl1_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ABR70133
UniProt: A6VUK4
Position
1345279..1346055
Genome map
AA seq 258 aa AA seqDB search
MASNGIIGKYDDLLFDEAENINDDKDYWFQIKGHNDNPLIDSATTFFGLSLRVKSLSECE
NIEEIYRQTIEEINIIEIELADKHYEHSVLMAYRYILCAFLDEAVMGTRWGGSSAWAEYS
MLSRFHNETWGGEKVFSILSRLEKDPEKYKDLLEFIYYCLVLGFEGKFKVLNNGKEEREK
VISKLHSLLDSMDEKESLKLTSKNDHVVNTRYKLSKQLPVWSVFAFFAAFWGLTFCGYLF
LLNSKSSNVLMQLNQILQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggctagtaatggcattattggtaaatatgatgatttgctttttgatgaagcagaaaac
ataaatgatgacaaggattactggtttcaaataaaaggccacaatgataatcctttaatt
gactctgcgacgactttctttggcttatctttaagggttaagtctttaagtgagtgtgaa
aatattgaagaaatatacaggcagactatcgaagaaattaacattatcgaaatagaactt
gctgataagcattatgagcattctgtgctgatggcatatcgctatatcttgtgtgctttt
ttggatgaagccgtcatgggaactcgatggggtggctcatctgcatgggctgaatactct
atgctatctcgtttccacaatgaaacatggggtggagagaaagtattttcaattttatct
aggttggaaaaagaccctgaaaaatataaggatctgctggaatttatttattactgtttg
gttttaggctttgaagggaagtttaaagttttaaataatggtaaagaagaaagggaaaag
gttattagtaaactgcattcacttttagattcaatggatgaaaaagaatctttaaagctg
acttctaaaaatgatcatgtagtaaatacccgttacaagttaagcaaacagttgcctgtt
tggtctgtttttgcattttttgctgctttttggggattaactttttgcggttatttattt
ttattgaacagcaaatcttcaaatgtacttatgcagcttaatcaaatactgcagtaa

DBGET integrated database retrieval system