KEGG   Marinomonas sp. MWYL1: Mmwyl1_1208
Entry
Mmwyl1_1208       CDS       T00567                                 

Definition
(GenBank) ImpA domain protein
  KO
K11910  type VI secretion system protein VasJ
Organism
mmw  Marinomonas sp. MWYL1
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1208
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mmwyl1_1208
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: ABR70137
UniProt: A6VUK8
Position
1350913..1352322
AA seq 469 aa
MDINLIRTSIREPISTDQPVGESAIHDPLYEFVDDQMMKVGSLSHGSVQWKKAEESLIEL
LSKKTKDLKLLTYFFQCLHNKNTPDSLTLSIFVLADFMSEYWETCFPFAGKKGNLPRRKF
LGQIIQRFGLALDKLDFANFTTSERESLRTANDFWHGVAKEQELASENVETIIEVINRKL
QNSEKKHVETQSKSQPQAEYKTVEVVPSKPAIEVDYSSAKSTKQTMLKVAEFLSENENSL
ELSIRIRRYAVWSPITTLPDNVNKQTLISALPQERVKDYWSLLDSADLALWKRVEATLTV
APYWFDGQFLSYQIAEKLGYTESAQAVLTETQRFLQRFPSLYDFTFKDGEVFVSDACRNW
LEQADETNVEETNLAGDSWAEKKKMAVDLVEKEGIGAALSMINEGISKAVEPRDNYYWRL
ISTELLEENKLNDLAQQQFQQLHTQVQSMSVSEWEPSLLKRVKKHITVK
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggacattaatcttattcgaacatcgattcgtgagcctatatccactgatcagcctgtt
ggcgaaagcgctattcatgatccgctttatgagtttgtggatgatcaaatgatgaaggtt
ggctctttgtctcatggttcagtgcaatggaaaaaagcagaagagtcgctaattgaactg
ctgagtaaaaaaaccaaggatctaaaactgctgacgtatttttttcaatgcctacacaat
aaaaatacaccagatagtttaactttatccattttcgttttagccgattttatgtcggaa
tattgggagacatgctttccattcgctggaaagaaagggaatttaccgagacgtaagttt
cttgggcaaattattcagcgttttggccttgctctagataagctggactttgccaacttt
actacctcagaaagagagagtttacgtactgccaatgacttttggcatggtgttgcgaaa
gaacaggaacttgcttctgagaatgttgaaaccatcatcgaggttattaacagaaagctc
caaaactcagaaaaaaagcatgtagaaacgcaaagtaaatctcaacctcaggctgaatat
aaaactgtagaggtcgtgccttctaaaccagcgattgaagtggattacagctctgcaaaa
agcactaagcagaccatgctgaaagtcgccgaattcctctcggaaaacgaaaatagtctg
gaattatccattcggattaggcgctatgcggtttggtcgccgattaccacattgccagat
aatgtgaacaagcaaactttgattagtgctttgccgcaagagcgagtgaaagactattgg
agcttgcttgatagtgcagacctagccttatggaagcgagttgaagccacgctgaccgtt
gcaccttattggtttgatgggcagtttctaagctatcaaattgctgaaaaattagggtac
acggaatctgctcaagccgttctaacggaaactcagcgatttcttcagcgttttccctcc
ctgtatgatttcacctttaaagatggtgaagttttcgtttctgatgcttgtcggaattgg
ctggaacaagcagatgaaacgaatgtagaagaaactaacctagctggtgacagctgggcg
gagaaaaagaaaatggccgttgatttagtggaaaaagaaggcattggtgccgctttatcc
atgatcaatgaagggattagtaaagcggtggagccaagggataattattattggcgcctt
atttctacggaattattggaagaaaataaactaaatgatttagcccagcagcagtttcag
caactacatacacaagttcagtcaatgtcggtttcggaatgggaaccctctttgctcaag
cgagtaaagaagcacattacagtcaaataa

DBGET integrated database retrieval system