KEGG   Marinomonas sp. MWYL1: Mmwyl1_1210
Entry
Mmwyl1_1210       CDS       T00567                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
mmw  Marinomonas sp. MWYL1
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1210
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mmwyl1_1210
SSDB
Motif
Pfam: ImpA_N DUF3915
Other DBs
NCBI-ProteinID: ABR70139
UniProt: A6VUL0
Position
1355932..1356609
AA seq 225 aa
MKNVIYIENRRFYIESDSSLIRDEELYCAIKDSINRRAALPKSNFDWQSVYSDAESLAES
VGVDLIIASYFTVAAFKTQGFRGLANGLTLINSALLNQNSHDLKQQKLNKGLVDWIRKEI
IIDIGSMQPSYDAMRDLYRCERECQILDDVLGSQLEMNEGIFEEIALHLLQYIERLEMRY
HRSEKVQERVVEELSKFSWNDTALVAAASLISAAFTFVVMLYWPK
NT seq 678 nt   +upstreamnt  +downstreamnt
atgaaaaatgtaatttatatcgagaataggcgcttttatatagagtctgactccagtctg
attcgagatgaagagctgtactgtgctatcaaagatagtattaatcgtagagccgcttta
cccaaaagtaactttgattggcaaagtgtttattcagatgctgagtcgctggcagaaagt
gttggggttgatttaatcatcgccagttactttaccgtcgcggcatttaaaactcagggc
tttcgtgggttggcaaacggtcttaccttaatcaactcggctttattaaatcaaaatagc
catgatttaaaacagcaaaagttaaataaaggcttagtagattggattagaaaagaaatc
atcatagatataggtagcatgcaacctagctatgacgcaatgcgagacctatatcgttgt
gagcgagaatgccagatcttagatgatgtgctaggcagtcagctggaaatgaatgaaggc
atctttgaagagattgcattgcatctcctgcagtacattgagcgtcttgagatgcggtat
caccgcagtgaaaaagtgcaagagcgagtggtagaagaactgtcaaaattttcttggaat
gataccgcgttagtggcggctgcaagtttgattagtgcagcatttacttttgttgtcatg
ttgtattggccgaagtga

DBGET integrated database retrieval system