KEGG   Marinomonas sp. MWYL1: Mmwyl1_1212Help
Entry
Mmwyl1_1212       CDS       T00567                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mmwyl1_1212
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1212
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mmwyl1_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 Phage_Mu_Gp45
Motif
Other DBs
NCBI-ProteinID: ABR70141
UniProt: A6VUL2
Position
1357553..1359652
Genome map
AA seq 699 aa AA seqDB search
MATLTFTLALDGMEDNTLLVREYQGHESLSDSLLKDGSPCYGFRYQLALASRQSDLSADT
IVDKNAELRVFRNGELIQRVHGIVCHFEKGDTGHHFTYYGLTLVPALERLSLRHNSRIFQ
KQTAQDIISQLLNEMGITEHLFDTQRTPLEREFCAQYRESDLDFVHRLAAEEGWVYYFTH
EEGKHQLHFADQSQFLPKHPTPIPYNVLSGGGSDDQYIATLTHHTQSLPSQAVLKDYSFK
KPDYRFLHQEDGENLYYQLPNYEHYDAPGRFKDDVTGKAFSRIRLEYLRRSARTLVGESN
HAAIQAGLKITIEGHSEDSINQEWLPVSVEHHGTQPQVLEEEGQSGSTNYHNRFTFIPAT
TNWQATPQPKPSVDGPMMAIVVGPEGEEIFCDEHGRIKLHFPWDRYSEANDHSSCWVRVS
QGWAGNQHGMMAIPRIGSEVIVSFLNGDPDQPIVTGRTFNAKNTPPYLLPDNKTKTVWRS
DTHQGEGFNEISFEDQVDNEKVYIHAQKDMETDVLNDRITHIGHDQHGQIDNDRFTQIGG
ENGTGNDHLTIKGESRHKIDKDHTLMVDGSLQQKVGSKAVLDAGNEVHLSSGVKLVVDAG
AELTLTAGGSFVKIDGSGVHLVGSAINLNSGGSAGSGSGFGGAQAETPLNVVSPEYDANL
EAPEGNEAPVVPVQQKQAIVTAAEQGTPICQACEEAATE
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggctacattgacgtttacactggcactcgacggcatggaagacaacactctgcttgtc
cgagaataccaagggcacgaatcgctctccgattccctgctaaaagacggctcgccttgt
tatggcttccgttaccaattggccctcgccagccgtcaatcggatctgtctgctgatacc
atcgtcgataaaaacgccgagctacgcgtgtttcgtaacggcgaactgattcaacgagtg
cacggcattgtttgccactttgaaaaaggcgacaccggacaccactttacctactatggc
ttaaccttggttccggcattggaacgcttatcgctacgtcacaacagccgtatcttccaa
aagcaaaccgcgcaagacatcatcagccaattgctgaatgaaatgggcatcaccgaacac
ctgtttgatacccaacgtacaccgcttgagcgcgagttctgtgcccagtaccgagaaagt
gacttagattttgtccaccgtttggcggccgaagaaggctgggtctactacttcacccac
gaagaaggcaaacaccaactgcactttgcagatcaaagccagtttttacccaaacaccca
accccgattccgtacaacgtcttatcaggtgggggctcagacgatcaatacatcgccacc
ctgacgcaccatacacaaagcttgcctagccaagctgtgctcaaagactacagcttcaaa
aagcccgactaccgcttcttgcaccaagaagacggcgagaacctatattaccagctgcca
aactacgaacactacgatgcccctgggcgttttaaagacgacgttacaggcaaagccttt
tcacgtatccgtctagaatatctacgtcgcagtgcgcgaaccttagtaggagaaagcaac
cacgccgccatccaagcgggcctaaaaatcaccatcgaaggccacagcgaagacagcatc
aaccaagaatggctgcccgtctcggttgaacatcacggcacccagccgcaagtcttggaa
gaagaaggccaatctggcagcacaaactaccacaaccggtttaccttcatcccagccacc
accaactggcaagcgacaccgcaacccaaacccagtgtcgatggccccatgatggccatt
gtagtgggacccgaaggggaagaaatcttctgtgatgaacacggacgcatcaaactgcac
ttcccatgggaccgatacagcgaagccaacgaccacagctcctgctgggtacgtgtctcc
caaggctgggctggcaaccaacatggcatgatggcgatcccaagaatcggcagcgaagtc
atcgtcagctttttaaatggcgaccccgatcaaccgatcgtgaccggacgtacctttaac
gccaaaaacaccccgccgtaccttctaccggacaataaaaccaaaaccgtctggcgcagc
gatacccaccagggtgaaggcttcaacgagatcagcttcgaagaccaagtcgacaacgaa
aaagtctacatccacgcgcaaaaagacatggaaaccgatgtacttaacgaccgcatcacc
cacatcggccacgaccaacacggacaaatcgacaacgaccgcttcacccaaatcggcgga
gaaaacggcacaggcaatgaccacctgaccatcaaaggcgaaagtcgtcacaagatagat
aaagatcacacgctgatggtagacggaagtctgcaacagaaagttggctcgaaagccgta
ctggatgcaggcaacgaagtacatctaagcagcggtgtgaaactggtcgttgatgcaggc
gccgaactcaccttaacggcagggggcagcttcgtaaaaatagatggctcaggcgtacac
ctcgtcggctcggccatcaatctaaactccggcggcagcgcaggatcgggcagtggcttt
ggcggggcacaagcggaaacaccgctaaatgtggtttcacctgagtacgacgctaacctt
gaagcgcctgaggggaatgaggcaccggttgttccggttcagcaaaaacaagccatagtc
accgccgcagagcagggcactcctatttgtcaggcttgtgaagaggcggcaacagaatga

DBGET integrated database retrieval system