KEGG   Marinomonas sp. MWYL1: Mmwyl1_1278Help
Entry
Mmwyl1_1278       CDS       T00567                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00900  Terpenoid backbone biosynthesis
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mmwyl1_1278
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Mmwyl1_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABR70207
UniProt: A6VUS8
Position
1429198..1430382
Genome map
AA seq 394 aa AA seqDB search
MALMQGICLLGATGSIGQSTLDIIAQHPDKFVLINASANESVDKMADICRRFKPQRVVMG
SQRARDELAQKCHDLAISFEWGEEALDSIASDSAVDQVMAAIMGFAGLKPTLAGIRAGKK
ILLANKESLVTAGKLFMDEVARHDVMLLPIDSEHNAIYQSLPQTARGAHKQDVSKVILTA
SGGPFRSWSLGEMATVTPEQACKHPNWSMGQKISIDSASLMNKGLELIEACWLFDITPNQ
VDVVVHPESIIHSMVSYLDGSVIAQMGNPDMKIPIAYGMSWPNRIETNVPPLSLIDIARL
NFEAPDLNRFPNLRLAADAWFMGGTAMAVLNATNEIAVAAFLKREIGFLDIARLNEKVLM
AADIVAVNDLDDVFEADRYSRHLALDMISRGSLS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctttgatgcagggtatttgcttgttaggtgcgactggttctattggtcaaagcacg
ttagatattattgctcagcaccctgataaatttgttttgattaatgcatcagctaatgaa
agcgtagataaaatggcggatatatgtcgtcgttttaagccccagcgtgtagtgatgggg
tcgcaaagggcgcgcgatgaattggctcagaagtgtcatgatttagctatttcgtttgaa
tggggcgaagaggccttagatagtattgcttctgactccgcagttgatcaggttatggct
gcaattatgggatttgctggtcttaagcctactttggctggtatacgtgctggcaaaaaa
atattgttagcaaacaaagagtccttggttactgctggtaagctttttatggacgaagta
gctcgccatgatgtcatgcttttgccaattgatagcgagcataatgcgatttaccaaagt
ttgccgcaaaccgctcgtggtgcacataagcaggatgtatcgaaagtgattttgacggcc
tctggtggtccgtttagaagttggtctttgggtgaaatggctacggtgacaccagagcaa
gcttgtaagcatcctaattggtctatggggcagaaaatatccattgattctgcttctttg
atgaataaaggtttggagttgattgaagcctgttggttgtttgatattacacctaatcaa
gtggatgtggtggtgcacccagaaagcattatccactcaatggtctcttatttagatggt
tctgtgattgcccaaatggggaatccagatatgaaaattcccatagcttatggaatgagt
tggccaaatcgtatcgaaacaaatgtccctcctttgagtttgattgatattgcccgtttg
aactttgaagcacctgatttaaatcgctttccaaatctaaggttggccgctgatgcttgg
tttatgggaggaactgcaatggcagtattaaatgcgaccaatgagatcgcagtcgctgct
tttttaaagcgtgaaattggctttttagatattgctcgactgaatgagaaagtcttgatg
gctgcagatattgttgctgtgaatgatcttgatgatgtttttgaggccgatcgatactct
cgtcacttggctctcgatatgatttctcgtggtagcttgtcatga

DBGET integrated database retrieval system