KEGG   Marinomonas sp. MWYL1: Mmwyl1_1533Help
Entry
Mmwyl1_1533       CDS       T00567                                 

Definition
(GenBank) Argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00220  Arginine biosynthesis
mmw00250  Alanine, aspartate and glutamate metabolism
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01130  Biosynthesis of antibiotics
mmw01230  Biosynthesis of amino acids
Module
mmw_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mmwyl1_1533
   00220 Arginine biosynthesis
    Mmwyl1_1533
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmw04147]
    Mmwyl1_1533
Enzymes [BR:mmw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     Mmwyl1_1533
Exosome [BR:mmw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmwyl1_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth Asn_synthase QueC NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ABR70461
UniProt: A6VVI2
Position
1715900..1717132
Genome map
AA seq 410 aa AA seqDB search
MSDVKKVVLAYSGGLDTSVIAKWLQEEYNCEVVTFTADLGQGEEVEPARAKAQALGIKEI
YIEDLREEFVRDFVFPMFRANTIYEGEYLLGTSIARPLIAKRLIEIANETGADAISHGAT
GKGNDQVRFELGAYALKPGVKVIAPWREWDLTSRETLMAYCEEHKIPVDFSTKKKKSPYS
MDANLLHISFEGDQLEDPWTEPEDDMWRWSVSPENAPNEPTYIEIGYEKGDPVSINGEAM
SPATILETLNKVGGANGIGRVDIVENRFVGMKARGCYETPGGTIMMKAHRAIESITLDRE
AAHLKDEMMPRYAKLIYNGFWWSEERRMMQALIDTSQKYVNGTVRLKLYKGNVTVVGRQS
DNSLFDSKIATFEDDAGAYDQKDAAGFIKLNALRMRIAAQKGRGFLDNDK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgtgaagaaggtagtgcttgcctattctggcggcctggatacttccgtaatc
gcgaagtggcttcaagaagagtataactgtgaagtggttacctttaccgctgatttgggt
cagggtgaggaagttgaaccagctcgtgctaaagctcaagcgttgggtattaaggaaatc
tacattgaagatttgcgcgaagagtttgttcgcgacttcgttttcccaatgttccgtgcc
aacactatttacgaaggcgaatacctattgggtacgtctattgcgcgcccattgattgct
aaacgtttgatcgagattgccaatgaaacaggtgccgatgctatttctcacggcgcaaca
ggtaaaggtaacgaccaagtacgttttgagcttggcgcttacgcattgaaacctggcgtt
aaagtaattgctccttggcgtgaatgggatctaacgtctcgtgaaaccctaatggcatac
tgtgaagaacacaaaatcccagttgatttttctactaaaaagaaaaaatctccttactct
atggacgctaacttactgcacatttcttttgaaggtgatcagttggaagatccatggaca
gagccagaagacgacatgtggcgttggtctgtctctccagaaaatgctccaaacgaacca
acttacatcgaaattggttacgaaaaaggcgacccagtttctatcaatggcgaagcaatg
tctccagcaactatcttggaaacattaaacaaagttggtggcgcgaatggtattggtcgt
gttgatatcgtagaaaaccgttttgttggtatgaaagcccgtggttgttatgaaacacct
ggtggcactatcatgatgaaagcgcaccgtgcgatcgaatctattaccctagaccgtgaa
gctgcgcatttgaaagatgagatgatgcctcgctatgctaagttgatctacaacggtttc
tggtggtcagaagagcgtcgtatgatgcaagctttgatcgacacatctcaaaaatacgta
aacggtactgttcgtcttaaattgtacaaaggcaacgtaacggttgttggtcgtcagtct
gataacagtctgtttgacagcaaaattgcgacttttgaagatgatgctggtgcatacgat
caaaaagatgcagcaggctttatcaagctaaacgcgcttcgtatgcgtattgctgctcag
aaaggtcgtggttttctagataacgacaagtaa

DBGET integrated database retrieval system