KEGG   Marinomonas sp. MWYL1: Mmwyl1_2015Help
Entry
Mmwyl1_2015       CDS       T00567                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mmwyl1_2015
Enzymes [BR:mmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Mmwyl1_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4434
Motif
Other DBs
NCBI-ProteinID: ABR70937
UniProt: A6VWV8
Position
2281426..2283399
Genome map
AA seq 657 aa AA seqDB search
MKLGVCYYPEHWPKSRWVEDAQHMRRIGIQYVRVGEFSWSTIEPTPGELHWEWLDESLDI
LHSQGLKVILGTPTATPPKWLVDRHPSMLAKDEAGRVRGFGSRRHYTFASLEYREECRRM
VTLMAERYGQHPAVASWQTDNEYGCHDTILSYAEADLAAFRLWLAEKYDTVEALNKAWGN
VFWSMDYRSFDEIELPNLTVTEANPSHRLDFQRCCSDQVVAFNKLQVDILREHSVDRDLV
HNYMGFFTAFDHHKVGQDLDVASWDSYPLGSLDKEPLYTEEEKHTYLRVGHPDAGAFHHD
LYRGCGNGRLWIMEQQPGPVNWAPHNPTPAEGAVRLWTWEAFSHGAELVSYFRWRQAPFG
QEQMHAGLLRPDAQEAEAAKEATLVAQEVKVLAESIGLDADELMSLPSAGKVALMFDYDA
CWSLDIQPQSRAYRYFFWCYRMYEAMRELGLSVDIIPSSGSLDTYELLVLPAQAHITPEL
QERLNAYQGVLLAGPRTGSKTETYQIPENLAPGPLASLLPLMVERVDALPEHTQPAVSGR
WGAGSLKHWHEQIKTQLPCLLKDDGGNPVLIGEGRHYYLGSCIDNTLLKASLAKLAGVAG
LSTCYLPKGVRVRERGNVIFVFNYSLNTVVFEPQDAELVIGSKSLGAADVAIWKNKK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaggtgtgtgttattacccagaacattggccaaaaagtcgttgggttgaagat
gctcaacatatgcgacgcattggtattcagtatgttcgagttggcgagtttagctggagt
acgattgagccaactccgggtgaactgcattgggagtggctggatgagtcgctagatatt
ttgcattctcagggtttaaaagtcattttaggtacgccaaccgcgacaccaccaaaatgg
ttggttgatcgtcatccgtctatgttggcaaaagatgaagcggggcgagtacgaggtttt
ggctctcgtcgtcattatacttttgcgagtttggaatatagagaagaatgtcgtcgcatg
gtgacattaatggcagagcgttatggtcagcaccccgccgtggcttcttggcagacagac
aatgaatacggctgtcatgacactattttaagttatgccgaagctgatcttgctgcgttt
cgtctttggttggcagaaaaatacgacacggtagaagcgttaaataaagcctggggcaac
gtgttctggagtatggattatcgctctttcgatgaaatcgaattgccgaatttaaccgtg
actgaagccaatccttcccatcgtttagattttcaacgttgctgttcagatcaagtggtt
gctttcaataagctgcaagtggatattttgcgtgagcattctgtagatcgcgatttagtg
cataactacatggggttctttacagcatttgatcatcataaagtcggtcaagatcttgat
gtggcgagctgggacagttatccattggggtctttagataaagagcctctttatactgaa
gaggaaaaacatacttatttgcgagtcggtcatccggatgcaggtgcatttcatcatgat
ttgtatcgtggctgtggtaatggtcgtttatggattatggagcagcagccaggtccggtg
aattgggcgcctcataacccaacaccagcagagggcgcagtacgtttatggacatgggaa
gctttttcccatggcgctgaactggtgtcgtatttccgctggcgtcaggcgccatttggt
caagagcaaatgcatgctggcttgttgcgtcctgatgcgcaagaagctgaagcggcaaaa
gaagcgaccttggtggcgcaagaggtgaaagtcttggctgaatcaattggccttgatgca
gatgagttaatgtccctgccaagtgctggaaaagtcgcattgatgtttgattatgacgct
tgttggtctttagatattcagcctcagtcccgtgcatatcgctactttttctggtgttac
cgaatgtatgaagccatgcgtgaacttggcttatccgttgacattattccaagctctggg
tcattggatacctatgaattgttggttttacctgctcaggcacatattactccagagttg
caagagcgtttgaatgcttatcaaggtgttttgcttgcagggccaagaacaggtagtaaa
acagaaacctatcaaatcccagagaaccttgcccctggtccattagcaagtttgcttcct
ttaatggtggagcgtgttgatgccttgcctgagcatactcagccagctgtttctggccgt
tggggcgcgggtagcttgaagcattggcatgaacaaattaagacacaattaccttgtttg
ttaaaagatgatggtggtaatccagtgttaattggagaaggccgtcactattatcttggc
tcttgtattgataatactctgttaaaagccagcttagctaagctggctggggtggcggga
ttatcgacttgctatttgccaaaaggcgttcgagtgagagagcgaggcaatgtaattttt
gtatttaattacagcttaaatacggttgtttttgagccacaagatgcagagcttgtcatt
gggtctaagtctttaggtgcagcagatgtcgccatttggaaaaacaaaaaatag

DBGET integrated database retrieval system