KEGG   Marinomonas sp. MWYL1: Mmwyl1_2205Help
Entry
Mmwyl1_2205       CDS       T00567                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
mmw  Marinomonas sp. MWYL1
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmw03016]
    Mmwyl1_2205
Enzymes [BR:mmw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Mmwyl1_2205
Transfer RNA biogenesis [BR:mmw03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    Mmwyl1_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 CytoC_RC
Motif
Other DBs
NCBI-ProteinID: ABR71127
UniProt: A6VXE8
Position
complement(2482739..2483467)
Genome map
AA seq 242 aa AA seqDB search
MTLDILFQDEHLVAVNKPAGLLVHRTNLAKDEEDAVVQRLRDQTGKWVFPVHRLDRGTSG
VLVMAFSPEVARRLSTQFAESKTQKTYHCLVRGYCNESGVINYPLAKLNEQKGRSRFKIE
GTEREAETGFTRLIQYQLPVPVSRYDSMRLSWLEVTPKQGRKHQIRRHFKHHLNPLVGDS
CYGCRHINKVAKELWSEDFRLMLHASSLEFNHPITNQPITLKADLSDKIINILNKLEYYR
TE
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacattagatattttatttcaagatgaacacttggttgccgtcaataaacctgcgggc
ttgctcgttcatcgcaccaatttagccaaagacgaagaagatgccgttgttcaaaggctg
agagatcaaacagggaaatgggtgtttcctgttcatcgccttgatcgaggcacatccggt
gtattagtgatggcatttagtccagaagtagcaagacgcctttccactcagtttgctgaa
tctaagactcagaaaacttatcactgcttagtacgtggatattgtaatgaatcaggtgtg
attaattatcctcttgctaagcttaatgagcagaaaggtagatcacgttttaaaatcgaa
ggtactgaaagagaggctgagactggctttactcgactaattcaatatcaacttcccgtt
cccgtgagtcgatatgacagcatgcgtttaagctggcttgaagtcacccctaaacaaggt
cgaaaacaccaaattcgtcgacattttaaacatcatctgaatccgctagtgggggattct
tgttatggctgtcgccatattaacaaagttgcaaaagagctttggtctgaggactttagg
ttgatgcttcacgcttcaagccttgaattcaatcaccctattacaaatcagccgattacg
ttaaaagcagatttaagcgacaagataattaatatacttaacaaactggaatattatcga
actgagtga

DBGET integrated database retrieval system