KEGG   Marinomonas sp. MWYL1: Mmwyl1_2736Help
Entry
Mmwyl1_2736       CDS       T00567                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00350  Tyrosine metabolism
mmw00643  Styrene degradation
mmw01100  Metabolic pathways
mmw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Mmwyl1_2736
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    Mmwyl1_2736
Enzymes [BR:mmw01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     Mmwyl1_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ABR71649
UniProt: A6VYX0
Position
complement(3098073..3098720)
Genome map
AA seq 215 aa AA seqDB search
MENVGTLYSYWRSSAAYRVRIALALKGLSYDTAFVHLVNGGGEQHSPEYKSLNAQGLVPS
WQDEEGVLTQSLAIIEYINDCHPDTPLLPAAPFARAKVRAMAQAIACEIHPINNLRVLKY
LRTSVGLDDDAVNSWYQHWVSEGLGALELMVEDDGFCYGNTPSLADICLIPQLYNARRFN
VDLTIYPKLCRIEANCLQLEAFKQAVPETQADAQL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgttggtacgctttattcctattggcgttcttctgcagcctatcgagtcaga
attgcgcttgctttaaaggggttatcttatgacaccgctttcgttcacttggttaacggc
ggcggtgagcagcattcccctgaatataagtcgttaaatgcgcaaggcttggtgccgagt
tggcaagatgaagagggcgtgctaacgcaatctttggcgattattgaatacatcaatgat
tgccatcctgatacgcctttgcttcctgcagcgcctttcgcacgtgccaaagtccgtgcg
atggcgcaagcgattgcctgcgaaatccacccgattaacaacttacgcgttcttaaatac
cttcgtactagcgtgggtttagacgacgatgcggttaatagttggtatcagcattgggtg
agcgaaggcttgggcgcattggaattaatggtcgaagatgacggtttttgttatggcaac
acgccatcgcttgcggatatctgtctgattcctcaactgtataacgctcgtcgttttaac
gtggacttaacaatctatcccaaattgtgtcgtattgaagccaactgtcttcagctagaa
gcatttaagcaagcggtgccagaaacccaagcagatgcacaactgtaa

DBGET integrated database retrieval system