KEGG   Marinomonas sp. MWYL1: Mmwyl1_3006Help
Entry
Mmwyl1_3006       CDS       T00567                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00010  Glycolysis / Gluconeogenesis
mmw00620  Pyruvate metabolism
mmw00640  Propanoate metabolism
mmw00680  Methane metabolism
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
mmw01130  Biosynthesis of antibiotics
mmw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmwyl1_3006
   00620 Pyruvate metabolism
    Mmwyl1_3006
   00640 Propanoate metabolism
    Mmwyl1_3006
  Energy metabolism
   00680 Methane metabolism
    Mmwyl1_3006
Enzymes [BR:mmw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mmwyl1_3006
Lipid biosynthesis proteins [BR:mmw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mmwyl1_3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABR71917
UniProt: A6VZN8
Position
complement(3393761..3395719)
Genome map
AA seq 652 aa AA seqDB search
MKSLYSATSNEAAKNANVSQAEFEKRYQESIENPDEFWGREGKRIDWFKPYTKVKNTSFK
RGEVSIKWFEDGELNVAYNCIDRHLAKSANKVAYYCEGDKESDEKVAITYQTLHDEVGRL
ANLLKRQGVKKGDRVAIYMPMIPQAVYAMLACARIGAIHSVIFGGFSAHAIADRLNDCEV
KLVITADEGRRAGNTIPLKHNVDMALDNNACPTVENVIVYRYTEKDVPWFEGRDLDWAVE
VENESTECPAERMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYASLTHELVFDLKPDDV
YWCAADVGWITGHSYMVYGPLANGTTSILFEGVPTYPDSGRIGRVVDKFDVTILYTAPTA
IRALMAKGDEATRSSKRDSLRVLGSVGEPINPEAWSWYYSEIGNSSCPIVDTWWQTETGG
MMMTPRIVQGDVKPGSCTGPLYGVQPALVDAQGVLQEEQGVLVEGGLVITDSWPGQARTV
YGDHERFEQTYFSTFDGMYFTGDGASRDADGHYWITGRMDDVLNVSGHRLGTAEIESALV
AHPSVAEAAIVGFPHDIKGQGIYVYVSAIAGVIPDEELTKSLKLFVRQEIGPIATPDLIQ
WTSKGLPKTRSGKIMRRILRKIAANEHDQLGDTSTLADPSVVDDLIENRLNV
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcattatatagcgcaacctcaaatgaggcggcaaaaaatgccaatgtgagtcaa
gcagaatttgaaaaacgctatcaagaatcgattgaaaatccagatgagttttgggggcga
gaagggaagcgtatagactggtttaagccttatacaaaagttaaaaacacctcttttaaa
cgaggcgaagttagcattaagtggtttgaagatggtgagttaaatgtggcttataactgc
attgatcgtcacttagctaaatctgcaaataaagtcgcttactactgtgaaggtgataaa
gaaagcgatgaaaaagtcgcaattacctaccaaacattacacgatgaggttggacgttta
gccaacctgttaaaacgtcagggcgttaaaaaaggcgaccgcgttgctatttatatgcca
atgattccgcaagccgtctacgctatgttggcgtgtgctcgaattggtgcgattcactct
gttattttcggtggtttttcagcgcatgctatcgccgatcgtttaaacgattgtgaagta
aagctggttattaccgcagacgaaggtcgtcgtgctggtaacactattcctcttaaacat
aatgttgatatggcgttggacaacaatgcttgtccaactgttgaaaatgttattgtctac
cgttacacagaaaaagacgtgccttggtttgaaggccgtgatttagactgggcggttgaa
gtagaaaacgaaagtactgaatgtccagcagaacgtatgaacgcggaagaccctttgttt
attctttatacatctggttcaaccggtaagccaaaaggtgtggtgcacacaacaggcgga
tatttggtgtatgcctcgttaactcatgaattggtatttgatcttaagccagatgatgtt
tattggtgtgccgctgatgtgggctggatcacaggccatagttatatggtttacgggcca
cttgctaatggcacaacgagcatcttatttgaaggggtgccaacgtatcctgattcaggt
cgaattggtcgcgtggttgataaatttgacgtgaccattctgtacacagcaccaacggct
attcgagctttgatggcgaaaggcgatgaagcgacgcgttcaagtaagcgagattcttta
cgagtattaggtagtgtgggtgagcctatcaacccagaagcttggtcttggtattacagc
gaaattggtaattcctcttgtcctatcgttgatacttggtggcaaactgaaactggtggc
atgatgatgacgccacgtattgttcaaggtgatgtaaaacctggttcatgtactggtcct
ttatatggtgtgcaacctgctttggtagacgcgcaaggcgtcttgcaagaagagcaaggc
gtgttagtggaaggtggtttggttattacggattcttggccaggccaggcgcgaactgtt
tatggcgatcatgagcgtttcgagcaaacttacttcagtactttcgacggtatgtacttc
actggtgacggcgcatctcgcgatgcagatggccattattggattactggccgtatggat
gatgtattgaacgtttcagggcatcgtcttggaacagctgaaatagaaagcgcattagtg
gctcatccttctgtcgctgaagctgctatcgtgggattccctcatgatattaaaggacaa
ggcatttatgtttatgtcagtgcgattgctggtgtgattccagatgaagaattgactaag
tcactaaagctgtttgttcgtcaagaaattggtcctattgcaacgccagaccttattcaa
tggacaagtaaaggtttgccgaaaacgcgatcaggtaaaattatgcgtcgaattttaagg
aagattgccgcaaacgaacatgatcaattgggtgatacaagtacattagctgatccaagt
gtggttgatgatttaatcgaaaaccgtttaaatgtgtga

DBGET integrated database retrieval system