KEGG   Marinomonas sp. MWYL1: Mmwyl1_3053Help
Entry
Mmwyl1_3053       CDS       T00567                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00071  Fatty acid degradation
mmw00072  Synthesis and degradation of ketone bodies
mmw00280  Valine, leucine and isoleucine degradation
mmw00310  Lysine degradation
mmw00362  Benzoate degradation
mmw00380  Tryptophan metabolism
mmw00620  Pyruvate metabolism
mmw00630  Glyoxylate and dicarboxylate metabolism
mmw00640  Propanoate metabolism
mmw00650  Butanoate metabolism
mmw00900  Terpenoid backbone biosynthesis
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
mmw01130  Biosynthesis of antibiotics
mmw01200  Carbon metabolism
mmw01212  Fatty acid metabolism
mmw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mmwyl1_3053
   00630 Glyoxylate and dicarboxylate metabolism
    Mmwyl1_3053
   00640 Propanoate metabolism
    Mmwyl1_3053
   00650 Butanoate metabolism
    Mmwyl1_3053
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mmwyl1_3053
   00072 Synthesis and degradation of ketone bodies
    Mmwyl1_3053
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mmwyl1_3053
   00310 Lysine degradation
    Mmwyl1_3053
   00380 Tryptophan metabolism
    Mmwyl1_3053
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mmwyl1_3053
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmwyl1_3053
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mmwyl1_3053
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmw04147]
    Mmwyl1_3053
Enzymes [BR:mmw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mmwyl1_3053
Exosome [BR:mmw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mmwyl1_3053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABR71963
UniProt: A6VZT4
Position
complement(3447539..3448714)
Genome map
AA seq 391 aa AA seqDB search
MKAVIVAAARTPIGAFNGALSSLSAVQLGTQLLSGMLAKQPILKDHIEEVILGQVLAAGC
GQNPARQTAIHAGLPKHVSAMTINKVCGSGLKAVQLAAQAVLNGDASMVVAGGQESMSQA
AHVLPNSRSGKKMGNWELLDSMVTDGLWDVFNDYHMGQTAENIANRWDISRQEQDAFAAN
SQQKAAQAQAAGRFVEEILPISIPQRKGEPIMVDADEQIRPDTTAESLGKLRAAFVKEGT
VTAGNASTLNDGAAMVIVTSDVEAERLGLPILAEIEAANGAGVDPEIMGTGPIAATQKVL
KKANWQVSDLDLIEANEAFAVQALCVNKELGLDASKVNVNGGAVALGHPIGASGCRILVT
LLHEMQRQDLNKGLATLCIGGGMGVAMLVSR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtcatcgttgctgctgcaagaacacctattggtgcttttaatggcgcttta
tcttcattgagtgcggtgcaattgggcactcaactcttgtctggcatgttagctaaacaa
cctatcttgaaagatcacattgaagaagtgattttaggtcaagtattagcggcaggctgt
ggtcaaaaccctgcccgtcaaacagctattcatgcaggcttaccaaaacatgtatccgct
atgacgattaataaagtctgcggttctggcttgaaagctgtgcaattagcggcgcaagct
gtgttgaacggtgatgccagcatggtcgttgcaggtggtcaagaaagcatgagtcaagct
gcacatgtgttaccaaacagtcgctcaggtaaaaaaatgggcaattgggaactgttggat
tccatggtgaccgatggtctgtgggatgtgtttaacgattatcacatgggacaaacggct
gaaaatattgctaatcgttgggacattagccgccaagagcaagatgctttcgctgcaaac
tcccagcaaaaagctgcgcaagcacaggctgcgggtcgatttgttgaagagattctacct
atctcaatacctcagcgtaaaggcgagcctattatggtcgatgctgatgaacaaattcgc
cctgatactacggctgaatctcttggcaaactgcgagcagcgtttgttaaagaaggcaca
gtcaccgcaggtaatgcatcgacgttgaacgatggtgctgccatggtgatagtgacatcc
gatgtagaagctgaacgtttggggttgccgattcttgctgaaattgaagccgcgaatggt
gcgggtgttgatcctgaaattatgggaacaggccccattgccgccactcaaaaagtgctg
aagaaagctaattggcaagtatctgacttggatctaatcgaagccaatgaagcttttgcg
gtgcaagctttgtgtgtcaacaaagagcttggtttggatgctagtaaggtgaacgtgaac
ggtggtgcggttgccttgggccatccgattggtgcttctggttgtcgaattctggttaca
ttgctccatgaaatgcaacgtcaagaccttaataaaggactggcgaccttgtgtattggt
ggtggaatgggcgttgctatgttggtttctcgttaa

DBGET integrated database retrieval system