KEGG   Marinomonas sp. MWYL1: Mmwyl1_3287Help
Entry
Mmwyl1_3287       CDS       T00567                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00670  One carbon pool by folate
mmw00790  Folate biosynthesis
mmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mmwyl1_3287
   00670 One carbon pool by folate
    Mmwyl1_3287
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mmwyl1_3287
    1.5.1.50  dihydromonapterin reductase
     Mmwyl1_3287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 Wax2_C Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: ABR72192
UniProt: A6W0G3
Position
complement(3725443..3726165)
Genome map
AA seq 240 aa AA seqDB search
MTRKMPIIITGGGQRLGLACAKALVAQGYEVIITYRREREDITILEGQGISCIQADFSSI
SGVDEFIATIQGRYSALGGIIHNASEWESEEDCSDTALLMEKMWQVHVFAPYRINLAFEA
LLCAGSEQDGQADIIHMTDYVAEKGSDKHIAYAASKAGLANLTCSFAKRFAPLIKVNAIA
PSLLMFNSGDDTEYRNKALNKSLLRKEPGEQEGVLAIQYILDSRYMTGRTLSLDGGRHLV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtaaaatgccaattattattaccggcggaggacagcgcctaggtcttgcctgt
gctaaagcgttagttgctcaaggatatgaggtaattattacttatcgtagagaacgagaa
gacattactatattagaaggacaaggaatttcttgtatacaggctgacttttcatctatc
tctggtgtggatgaatttattgctacaatacaaggtcggtattcagcacttggtggaatt
attcataatgcttctgagtgggagtctgaagaagattgttcggatacggcgttattaatg
gaaaaaatgtggcaagtccacgtatttgcgccttatcgtataaatctagccttcgaagca
ttattatgtgcaggttctgagcaagatgggcaagcagacattattcatatgacggattat
gtcgctgaaaaaggcagtgataaacacattgcttatgctgcaagtaaagcgggcttagcg
aacttaacttgctcatttgctaaacgatttgcacctctaattaaggttaatgcgatcgca
ccatcacttttaatgtttaacagtggcgatgatacagaatatcggaacaaagcattgaat
aaatccttgctgcgcaaggagccaggggagcaagaaggtgtgctcgcaatacagtacata
ttagacagtcgttatatgacaggtcgaaccttgtcacttgatggaggccgacatttggtc
taa

DBGET integrated database retrieval system