KEGG   Methanococcus maripaludis C6: MmarC6_0189Help
Entry
MmarC6_0189       CDS       T00615                                 

Definition
(GenBank) Proteasome endopeptidase complex
  KO
K03433  proteasome beta subunit [EC:3.4.25.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx03050  Proteasome
Module
mmx_M00343  Archaeal proteasome
Brite
KEGG Orthology (KO) [BR:mmx00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    MmarC6_0189
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmx01002]
    MmarC6_0189
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmx03051]
    MmarC6_0189
Enzymes [BR:mmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     MmarC6_0189
Peptidases [BR:mmx01002]
 Threonine Peptidases
  Family T1: proteasome family
   MmarC6_0189
Ubiquitin system [BR:mmx04121]
 Proteasome
  Prokaryotic proteasome
   Core particles (20S proteasome)
    MmarC6_0189
Proteasome [BR:mmx03051]
 Prokaryotic proteasome
  Core particles (20S proteasome)
   MmarC6_0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proteasome
Motif
Other DBs
NCBI-ProteinID: ABX01012
UniProt: A9A788
Position
171338..171997
Genome map
AA seq 219 aa AA seqDB search
MISNSEYHKEYMKGTTTVGLLCKDGVVLATDKRATMGNLIADKEAKKLYKIDDYIAMTIA
GSVGDAQSLIRLISAEAKIYKMRTGNNMTPLSCTTLISNVLHGNRHYPLLTQLILGGYDL
INGAKLFSLDPVGGINEESSFTATGSGSPTAYGVLEAEYRSDVTIDKGLLVAVKALSSAM
QRDAYSGNGISLAHINKDGVNIYSDEEIEGFLKKINKKR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatatccaacagcgaataccataaagagtatatgaaaggaacgaccaccgtaggatta
ctttgtaaggatggcgtcgttttagctactgataaaagggctactatgggcaatcttatc
gcggataaagaagcgaaaaagttatataagattgatgactacatagcaatgactatagct
ggaagtgttggtgatgctcagtcactcataaggcttatttctgcggaagcaaaaatatac
aagatgagaactggaaacaatatgactcctctttcctgcactacattaataagtaacgtc
ttgcatggtaacagacactaccctcttttaacacaattaatactcggtggatacgacctg
attaacggagctaaactgttttcactcgatccagttgggggcattaatgaagaatcttca
ttcactgccacaggatcaggttcacctactgcttacggagtacttgaagcagaataccgt
tctgatgtcacaatagacaaaggattattagttgctgtaaaagccctttcgtctgccatg
caaagagatgcatactctggaaatggtatttccctagctcatatcaataaagatggggta
aacatatattcagacgaagaaattgagggttttttgaaaaaaatcaacaaaaaaagataa

DBGET integrated database retrieval system