KEGG   Methanococcus maripaludis C6: MmarC6_0200Help
Entry
MmarC6_0200       CDS       T00615                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00010  Glycolysis / Gluconeogenesis
mmx00051  Fructose and mannose metabolism
mmx01100  Metabolic pathways
mmx01110  Biosynthesis of secondary metabolites
mmx01120  Microbial metabolism in diverse environments
mmx01130  Biosynthesis of antibiotics
mmx01200  Carbon metabolism
mmx01230  Biosynthesis of amino acids
Module
mmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmx_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC6_0200
   00051 Fructose and mannose metabolism
    MmarC6_0200
   00562 Inositol phosphate metabolism
    MmarC6_0200
Enzymes [BR:mmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MmarC6_0200
Exosome [BR:mmx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MmarC6_0200
  Exosomal proteins of bladder cancer cells
   MmarC6_0200
  Exosomal proteins of melanoma cells
   MmarC6_0200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh His_biosynth IGPS
Motif
Other DBs
NCBI-ProteinID: ABX01022
UniProt: A9A798
Position
complement(182952..183635)
Genome map
AA seq 227 aa AA seqDB search
MKGGGTIKPNVIINYKTYTESVGKSGLAIAKAAEKVSEESGVTIGVAPQFLDLRMILDEV
NIPVYAQHMDAVNPGSSTGHILPDALKDAGVTGTLLNHSERRMLLADLEKCIEISNKLGL
KTVVCTNNIPVSKAVSALNPTSIAVEPPELIGSGIPVSKANPEVVSGTVREVREINKNVE
ILCGAGISKGEDVKSALELGTNGVLLASGVVKAKCVEDAIRELIAEI
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
attaagggcggtggtactatcaagccaaatgtaatcataaattacaaaacatacactgaa
agtgttggtaaaagcggtttagcaattgcaaaagctgcagaaaaagtttcagaagagtca
ggagttactatcggggtagcacctcaatttttagatttaagaatgattttagacgaagta
aacatcccagtatatgcgcaacacatggatgcggtaaatcccggaagcagtactggacat
atattaccagatgcattaaaagacgcaggggttacaggaactcttttaaaccactctgag
agaagaatgcttcttgcagaccttgaaaaatgcattgaaatttcaaataaacttggatta
aaaactgttgtatgtacaaacaatatacctgtttcaaaagcagtttctgcgctaaatcca
acttcaattgcagtagaacctccagaattgattggaagtggaatacctgtttcaaaagca
aatcctgaagtagtttcaggaactgtgagagaagttcgagaaattaacaaaaacgttgaa
atattgtgcggtgcaggaatttcaaaaggggaagacgtaaaatctgcgcttgaacttgga
acaaacggcgttttgcttgcatcaggagttgtaaaggctaaatgcgttgaagatgcaata
agagaattaattgcggaaatttaa

DBGET integrated database retrieval system