KEGG   Methanococcus maripaludis C6: MmarC6_0522Help
Entry
MmarC6_0522       CDS       T00615                                 

Definition
(GenBank) geranylgeranyl reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mmx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MmarC6_0522
Enzymes [BR:mmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     MmarC6_0522
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     MmarC6_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 HI0933_like FAD_oxidored Lycopene_cycl Pyr_redox_2 FAD_binding_2 Trp_halogenase GIDA NAD_binding_8 DAO Thi4 Pyr_redox_3 AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABX01339
UniProt: A9A6R1
Position
481819..482991
Genome map
AA seq 390 aa AA seqDB search
MRALNDSYDVVVVGAGPAGSMASYNASKNGAKTLLIEKSQEIGTPVRCAEAVPRLEDFGI
NPDPSFVRSYIKGGYLIAPNGKKVVVKGGKTDGYVVERKVFDKFLAIRSGQAGTQIAVKS
RVTKIEKTDDGYDVFVNYLGDEYIVKTKIVIAADGVESNIAEYAGLKSKKSSKEICSCAE
YEMTNVKLLDNEMMEFYFGDICPKGYIWLFPKGDTVNVGIGIIDSKKRALDYLDEFLTNP
LVEGRLDNAVPIEFKVGGDPVGGPIEKTVADNIMVVGDAAGHVSPLTGGGIGLSMACGVM
AGEVAAESTKAEDYSEEFLNLYEKRWKERYYKPLMKDLKYKNILQKLSDEELNAIADSIP
ENLEEVDVGKLAVKIVAKAPSLLRHFKELL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagggctttaaacgatagctatgatgtagttgtagttggtgcagggcctgcgggcagt
atggcttcttacaacgcatccaaaaatggggcaaagacacttctaattgaaaaatcccaa
gaaatcggaacgccagtaaggtgtgctgaagcagttcctagacttgaagatttcggaatt
aatccagatccatcatttgttcgctcatacattaaaggaggatatctaatcgctccaaac
ggtaaaaaagtagtcgtaaaaggcggaaaaacggacggctacgttgttgaaagaaaagta
tttgacaaattccttgcaataagaagcggtcaagctggcactcagattgcagttaaaagc
agagttaccaaaattgaaaaaactgatgatggatacgacgtctttgtaaactaccttgga
gacgaatatattgttaaaacaaaaatcgtgattgctgcagatggtgttgaaagcaacatt
gcagagtacgcaggattaaaatcaaagaaaagttccaaagaaatctgttcatgtgcagaa
tacgagatgaccaatgtaaaattgttagataatgagatgatggaattttactttggagac
atatgtcctaaaggatacatctggttattcccaaaaggcgacactgtaaacgtaggtatc
ggtatcattgatagcaaaaaaagagcacttgattatttagatgaatttttaactaatccc
ttagttgagggaaggcttgataatgcagttccaattgagttcaaagttggtggtgatcca
gtaggtgggccaattgaaaaaacagttgctgataacatcatggttgtaggggatgctgca
ggacatgttagcccgcttaccggtggtggaataggcctttcaatggcttgtggtgtaatg
gcaggagaagttgctgcagagagtaccaaagcagaagactattcagaagagtttttaaat
ctttacgaaaaaagatggaaagaaagatactacaaaccattaatgaaagatttaaaatac
aaaaatatacttcaaaaattaagtgatgaagaattgaatgcaattgctgattcaatccct
gaaaatttagaagaagtagatgttggaaagcttgcggtaaaaatagttgcaaaagctcca
tccttattaaggcattttaaagaattactctaa

DBGET integrated database retrieval system