KEGG   Methanococcus maripaludis C6: MmarC6_1109Help
Entry
MmarC6_1109       CDS       T00615                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00680  Methane metabolism
mmx01100  Metabolic pathways
mmx01120  Microbial metabolism in diverse environments
mmx01200  Carbon metabolism
Module
mmx_M00357  Methanogenesis, acetate => methane
mmx_M00567  Methanogenesis, CO2 => methane
mmx_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmx00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MmarC6_1109
Enzymes [BR:mmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MmarC6_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD
Motif
Other DBs
NCBI-ProteinID: ABX01923
UniProt: A9A9A0
Position
complement(1042813..1043520)
Genome map
AA seq 235 aa AA seqDB search
MDATSFILPLAEITIAGAIINASVHFVPVGGAPAAMATSTGVGTGTTQLAAGAGFTGLLA
AATMASQAGVSLANPVHMLLIMLSGAVGAMIMLGLTMLIGQIIYVYGIGIVPAADKCEKD
PITGDVQKPYITPGTTGHGIPTVCFVSGSIGAALGGLGGALAYIALQQLGFAAAIAGVLA
VGFFFMNAVLASYNIGGTIEGFHDPKFKKMPNGVIASFVSSLIAGAVLIGMAMGL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggatgctacaagctttatattacctcttgcggaaataaccattgcgggagcgattatc
aacgcaagcgttcacttcgttccagtaggtggtgctccagcagcgatggctacttcaaca
ggggtaggtacaggtacaacacagttagcagcaggtgcaggttttaccggtctcttggct
gcagctacaatggcttcacaagcaggagtttcattggctaacccagttcacatgttatta
atcatgttatctggtgctgtcggtgcaatgatcatgttaggccttacaatgttaatcggt
caaattatctatgtatacggtattggtatcgtccctgcagcagataaatgtgaaaaagac
ccaattacaggagatgttcaaaaaccatacatcacaccaggtacaacaggacacggtatt
ccaaccgtttgtttcgtaagtggttcaattggtgcagcgctcggtggtctcggtggtgct
cttgcatacatcgcactccaacagttaggatttgctgcagctattgctggtgtattggca
gtcggtttcttctttatgaacgcagttttagcttcatacaacattggtggtacaatcgaa
ggattccacgaccctaaatttaagaaaatgccaaacggagttattgcttcatttgtttct
tcattaatcgcaggtgcagtattaattggaatggctatgggactttaa

DBGET integrated database retrieval system