KEGG   Methanococcus maripaludis C6: MmarC6_1187Help
Entry
MmarC6_1187       CDS       T00615                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K19266  lactaldehyde dehydrogenase [EC:1.2.1.22]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00620  Pyruvate metabolism
mmx01100  Metabolic pathways
mmx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MmarC6_1187
Enzymes [BR:mmx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.22  lactaldehyde dehydrogenase
     MmarC6_1187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABX02000
UniProt: A9A9H7
Position
complement(1114206..1115603)
Genome map
AA seq 465 aa AA seqDB search
MFIDGKWNIREDIDVFDPYTLENIEKITALDREETKNAIEITEKNKEVMKNLSPSKRYNI
LMRIAEQISLKKDLFAKTISIDVGKPIKQSKIEVDRTLTAFRLSAFYAKELRGETINSEN
GLIFTKKEPLGVIGAITPFNFPLNLITHKIGPAIATGNSVILHPSSKAPIAAIYLTKIIE
HVLKQMEIPRGVFNLATGNGDIVGDEISKNDNINMVSFTGSVEVGESISKNAKMKKVALE
LGGNNPMIVLKDSDIKLAAKSAVKSKFLNAGQVCISVGQVLVEKEVLETFTKHVIEETKK
LILGNPLDTKTDIGPLISPESALRIENLIKESVNEGGELLIGGNRQNSLISPAVINIDED
NILSKIETFGPVLPILKVKGGEEAVAIANNSKYGLQAGVFTNDINQAMKIADSLEYGGIM
INSSPTFRKDNMPFGGVKKSGLGREGIKYTVEEMCETKTIVIHNI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcgatggaaaatggaatataagagaagatatcgatgtttttgacccgtacacg
ttagaaaatatcgaaaaaataactgctcttgatagggaagaaacaaaaaatgcaattgaa
attacggaaaaaaataaagaagtaatgaaaaatttaagcccctcaaaaagatacaacatt
ttaatgagaattgcagaacaaatcagcttaaaaaaagatctttttgcaaaaacaatttca
attgatgttggaaaaccaataaaacagtctaaaatagaagttgacagaactttgactgca
tttaggctttctgcattctatgcaaaagaacttcgtggagaaacaattaattcagaaaat
ggtttaatatttacaaaaaaagagcctttgggagtaattggagcaataactccatttaat
tttccattaaatttaataacacacaaaattggccctgcaattgccactggaaattcagtt
atattacacccgtcatcaaaagcaccgattgccgcaatatatcttacaaaaattatagaa
catgttttaaaacagatggaaattccaagaggagtatttaatcttgctacgggaaatgga
gatattgtaggggatgaaatatcaaaaaatgataatataaacatggtctcatttaccgga
agcgttgaagttggagaatcaatatcaaaaaatgcgaaaatgaaaaaagttgcacttgaa
cttggtggaaataacccaatgatagttttaaaagattcagacatcaaattggccgccaaa
tctgcggttaaaagtaaatttttaaatgcaggacaggtatgtatctctgttggacaggta
ctcgttgaaaaagaagttttagaaacttttacaaaacatgttatcgaagaaactaaaaaa
ctaattttaggaaatccactcgatactaaaacagacattggaccactcataagtcctgaa
agcgccttacgaattgaaaatttaataaaagaatccgtaaatgaaggtggggaactatta
attggcggaaatagacagaacagcttgatttctcctgctgtcatcaacattgatgaagat
aatattttatcaaaaattgaaacttttgggccagttttaccgatattaaaagtaaaaggt
ggcgaagaagcagtagctattgcaaataattccaaatatggacttcaggccggagtattc
acaaatgatataaatcaagctatgaaaatagcagattcattggaatacggcggaataatg
ataaacagtagtcccacatttagaaaggacaacatgccttttggtggagttaaaaaaagc
ggtcttggaagggaaggcataaaatatacggtagaagaaatgtgcgagacaaaaacgatt
gtaattcataacatttaa

DBGET integrated database retrieval system