KEGG   Methanococcus maripaludis C6: MmarC6_1194Help
Entry
MmarC6_1194       CDS       T00615                                 

Definition
(GenBank) homoaconitate hydratase family protein
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00300  Lysine biosynthesis
mmx00680  Methane metabolism
mmx01100  Metabolic pathways
mmx01120  Microbial metabolism in diverse environments
mmx01130  Biosynthesis of antibiotics
mmx01210  2-Oxocarboxylic acid metabolism
mmx01230  Biosynthesis of amino acids
Module
mmx_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mmx00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MmarC6_1194
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MmarC6_1194
Enzymes [BR:mmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     MmarC6_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-ProteinID: ABX02007
UniProt: A9A9I4
Position
complement(1119901..1121157)
Genome map
AA seq 418 aa AA seqDB search
MTLAEKIISKNVGKNVYAGDSVEIDVDIAMTHDGTTPLTVKAFEQITDKVWDNEKIVIIF
DHNIPANTSKAANMQLITREFIKKQGIKNYYLDGEGICHQVLPEKGHVKPNMIIAGADSH
TCTHGAFGAFATGFGATDMGYVYATGKTWLRVPETIRVNVTGENENISGKDIILKTCKEV
GRRGATYMSLEYAGNAVQNLDMDERMVLSNMAIEMGGKAGIIEADDTTYRYLENAGVSRE
EILNLKKNKITVNESEENYYKTVEFDIIDMEEQIACPHHPDNVKGVSEVSGTELDQVFIG
SCTNGRLNDLRTAARYLKGKKVNESTRLIVIPASKSIFKEALKEGLIDIFVDSGALICTP
GCGPCLGAHQGVLGDGEICLATTNRNFKGRMGNTKSEVYLSSPAIAAKSAVKGHITNE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgctgagaaaatcatttctaaaaatgttggaaaaaatgtttacgcgggcgat
agcgttgaaatagacgtggatatcgcaatgacccatgatggaactaccccgcttactgta
aaagcttttgagcagattacagataaagtttgggataacgaaaagatagttattattttt
gaccacaatatccctgcaaacacgtcaaaagctgcaaacatgcaacttataacgagagaa
tttattaaaaaacagggaattaaaaattactatcttgatggcgaaggaatatgtcatcag
gtacttcctgaaaaaggtcacgtaaagccaaacatgataattgcaggagctgacagccac
acctgtactcatggggcatttggggcatttgcgaccggttttggtgcaacagatatgggt
tacgtttatgcaaccggaaaaacctggcttagagttcctgaaaccattcgggtaaacgta
accggagaaaatgaaaatatctctggaaaggatataatcttaaaaacttgtaaagaagtt
ggaaggcgtggagctacatacatgtctttggaatacgcgggaaacgcagttcaaaacctt
gacatggacgaaagaatggttttatcgaatatggcaattgaaatgggtggaaaagccgga
attatcgaagctgatgataccacttacagataccttgaaaatgcaggagtttcgcgtgaa
gaaattcttaacttgaaaaaaaataaaataacagttaatgaatccgaagaaaactactac
aaaacagttgaatttgatataatagatatggaagaacaaattgcttgcccacaccacccg
gacaatgtaaaaggagtttctgaagtatctggaactgaattagatcaagttttcatcggt
tcatgtactaacggaagattaaacgatttgagaactgctgcaagatatttgaaaggaaaa
aaagttaatgaaagtacccgattgatcgtaattcctgcatcaaaatcaatattcaaagaa
gcattgaaagaaggattaattgatatttttgtagattctggggcattgatctgtactccg
ggatgtggaccttgccttggagcccatcagggtgttttaggtgatggagaaatatgcctt
gcgaccactaacaggaattttaaggggagaatgggtaacaccaaatcggaagtttacctc
tcatctcctgcaatagctgcaaaatctgcggttaaaggacacattacaaatgaataa

DBGET integrated database retrieval system