KEGG   Methanococcus maripaludis C6: MmarC6_1429Help
Entry
MmarC6_1429       CDS       T00615                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K00204  4Fe-4S ferredoxin
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00680  Methane metabolism
mmx01100  Metabolic pathways
mmx01120  Microbial metabolism in diverse environments
mmx01200  Carbon metabolism
Module
mmx_M00567  Methanogenesis, CO2 => methane
mmx_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MmarC6_1429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_7 Fer4_9 Fer4_21 Fer4_2 Fer4_10 Fer4_17 HTH_3 Fer4_22 HTH_19 Fer4_15 Fer4_19 Fer4_13 HTH_23
Motif
Other DBs
NCBI-ProteinID: ABX02242
UniProt: A9AA69
Position
complement(1333189..1333635)
Genome map
AA seq 148 aa AA seqDB search
MPEHILSGIKAVVAINMRKEGKLQREIAEFLEMDRSIISHYLHGRYPSDKVMRVSEEIIN
LPREYGIPLITSLGDNKQITKKLIERIYNIKINIDMEKCIACGKCLECEYGAISVYSEDI
GISIDREKCILCCKCVSECPVGALKIVK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacatattctatcagggatcaaagcagtagtcgcaataaatatgcgaaaagaa
gggaaacttcaaagagagatagcagagtttctagaaatggatcgttcaatcatctcccac
tacctacacggcagatatccatcagataaggtcatgagagtctctgaagagattataaat
ttaccccgagaatacggtattccactaattacttcgcttggtgacaacaagcagattact
aaaaagttaatagaacggatttataatataaaaataaatattgacatggaaaagtgtatt
gcatgtggcaaatgccttgaatgcgaatacggggcaatttcagtatattccgaagatatc
ggtatatcgatagacagagaaaaatgcattctttgttgtaaatgcgtttccgaatgtcct
gttggtgctttgaaaatagtcaaataa

DBGET integrated database retrieval system