KEGG   Methanococcus maripaludis C6: MmarC6_1727Help
Entry
MmarC6_1727       CDS       T00615                                 

Definition
(GenBank) CheD
  KO
K03411  chemotaxis protein CheD [EC:3.5.1.44]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mmx00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    MmarC6_1727
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:mmx02035]
    MmarC6_1727
Enzymes [BR:mmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     MmarC6_1727
Bacterial motility proteins [BR:mmx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MmarC6_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheD
Motif
Other DBs
NCBI-ProteinID: ABX02539
UniProt: A9AB16
Position
complement(1623740..1624204)
Genome map
AA seq 154 aa AA seqDB search
MVLKVKMGDIGVAKSPESIETLLGSCVAIILYDRGKKVGGVAHVMLPKSRNAAEKNPGKY
ADTALPELLDRMTKLGARKDKLTAKLAGGAAMFKCNSNTIDVGKKNIEASKEEVRKVGLR
IASEDLGGDIGRTITLSLKDGSVIVRKGAELKTI
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttttgaaggtaaaaatgggtgacatcggggttgctaaaagccccgaatcgattgaa
accctgttaggatcttgtgtggccattatattatatgaccgaggtaaaaaagttggtggt
gttgcccatgtaatgctccctaaatcaagaaatgcggcagaaaaaaaccctggaaaatat
gcagatactgcacttccagaattacttgatagaatgactaaactaggcgctagaaaagat
aaattaactgctaaacttgcaggtggtgctgcaatgtttaaatgcaattcaaatacgata
gatgtaggcaaaaaaaatattgaagcttcgaaagaagaagtcagaaaagtaggcttaaga
atagcttctgaagaccttggtggcgatataggtagaacgattactctatcccttaaagat
ggaagtgttatagtcagaaaaggtgctgaacttaaaactatataa

DBGET integrated database retrieval system