KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0017Help
Entry
MSC_0017          CDS       T00161                                 

Gene name
mtlD
Definition
(RefSeq) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
mmy00051  Fructose and mannose metabolism
mmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MSC_0017 (mtlD)
Enzymes [BR:mmy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     MSC_0017 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 2744562
NCBI-ProteinID: NP_975028
UniProt: P55800
Position
complement(23628..24614)
Genome map
AA seq 328 aa AA seqDB search
MNLIHFGAGNIGCGFIAPILSSIVDHIYFVDNNIDIVNKINTQKLIKIHTSDSKKISITN
ISAWLLTDFINYKKTWNEVSLLTISIGIKNLKHIIYYVNQLIDYKIKNNQKLIIMCCENG
IRVSSLFKSYFSNLNNNIYFVDVLVDRIVSNKNILNDYLECEDYYLWIVDKTQLPSDFKQ
VPNLTYTTSFDIQITKKIYMLNALHCSLAWFVFKNFSFNKYLYVYQALKNDKVVEFVNNY
LNEVILVLNHKYNINLDELNNYKNQIIKRLNSNFIKDDLKRLARNTELKLSKNERILTIL
DYAKDNNLKHDILLLSYQNGLEYLKNNK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaattcactttggagcaggaaacatcggttgtggttttattgctccaatttta
agctctattgttgatcatatttattttgttgataacaatattgatattgttaataaaata
aatactcagaaattaattaaaatacatacttcagatagtaaaaaaataagtataactaac
atttcagcttgactattaactgattttataaattataaaaagacttgaaatgaagttagt
ttattaactatttcaattggaattaaaaacttaaaacatattatttattatgttaatcaa
ttaatagattataagatcaaaaataatcaaaaactaattattatgtgttgtgaaaatgga
attagagttagtagcttatttaagtcttatttttctaatttaaacaataatatttatttt
gttgatgttttagttgataggatagttagtaataaaaacattctaaatgattatttagaa
tgtgaagattattatttatgaattgttgataaaactcaattaccaagtgattttaaacaa
gtacctaacttaacttatacaactagttttgatatacaaataactaaaaagatttatatg
ttaaatgctttgcattgttctttagcttggtttgtttttaaaaactttagttttaacaag
tatttatatgtttatcaagccttaaaaaatgataaagtggttgaatttgttaataattat
ttaaatgaagttattttagttttaaatcataaatataatattaatttagatgaattaaat
aattataaaaatcaaataattaaaagattaaatagtaattttataaaagatgatcttaaa
agattagctagaaatactgaattaaaactaagtaaaaatgaaagaattttaactatttta
gattatgctaaagataataatttaaaacacgacatacttttgttaagctatcaaaacgga
ttagaatatttaaaaaataataaatag

DBGET integrated database retrieval system