KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0837Help
Entry
MSC_0837          CDS       T00161                                 

Gene name
pldB
Definition
(RefSeq) lysophospholipase
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
mmy00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MSC_0837 (pldB)
Enzymes [BR:mmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MSC_0837 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S9 Ndr Abhydrolase_6 LIDHydrolase Abhydrolase_5 Esterase PGAP1 Ribosomal_L24e DUF915 RMMBL
Motif
Other DBs
NCBI-GeneID: 2745248
NCBI-ProteinID: NP_975809
UniProt: Q6MSD9
Position
complement(951302..952207)
Genome map
AA seq 301 aa AA seqDB search
MKSEILISKDNKQLVLYKWDEVTRPLAVIQLVHGSCEHIKRYEDFIKQMNQNNVIVIGID
QRGHGQTSVLNNELGYFNKTKGWDCLIQDQLLVNQYIKTNYTNLPIYMLGHSMGSFVARS
YAIKYSNTIKGLILSGTNQTNSFTLLSALVLTKLTSLFLKEKQPNKIIWNISYKQLNKKF
KTNNSNGVEWLTRDTNIQNQFLNDKLCGFVFSSSAFKDMFKGMLFNLKTKNIKKMNHDLR
ILLLTGSDDPVSHYSKDVIKLNNKLEKLGYDSKLIIYKDSRHEILNELDKNLVIRDILKF
M
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgaaattctaattagtaaagataataaacaattagttttatataaatgagat
gaagtaacaagaccactagcagtgattcaactagttcatggtagttgtgaacatataaaa
agatatgaagattttataaaacaaatgaatcaaaataatgtaatagtaattggtattgat
caaagaggtcatggacaaactagtgttttaaacaatgaacttgggtattttaataaaact
aaaggttgagactgtttaatacaagatcaattattagttaatcaatatattaaaactaat
tatactaatttacctatttatatgcttggtcattcaatggggagttttgttgctagaagt
tatgctattaaatatagtaatactattaaagggctaattttaagtggaactaatcaaact
aatagttttactttactttcagctttagttttaacaaaactaacttctttatttttaaaa
gaaaagcaaccaaataaaattatttgaaatattagttataaacagttaaataaaaagttt
aaaactaataatagtaatggagttgaatgactaactagagatacaaatattcaaaatcaa
tttttaaatgataagttatgtgggtttgtttttagtagtagtgcttttaaagatatgttt
aaaggaatgttatttaacttaaaaactaaaaatataaaaaagatgaatcatgatttaaga
attttattactaactggtagtgatgatcctgtaagtcattatagtaaagatgtaattaaa
ctaaataataaattagaaaaattaggttatgattcaaaactaattatttataaagattct
agacatgaaatcttaaatgaattagataaaaatttagtaattagagatattttaaaattt
atgtaa

DBGET integrated database retrieval system