KEGG   Mycoplasma mycoides subsp. mycoides SC Gladysdale: MMS_A0012Help
Entry
MMS_A0012         CDS       T02595                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mmym  Mycoplasma mycoides subsp. mycoides SC Gladysdale
Pathway
mmym00450  Selenocompound metabolism
mmym00970  Aminoacyl-tRNA biosynthesis
mmym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmym00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MMS_A0012 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MMS_A0012 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmym01007]
    MMS_A0012 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmym03016]
    MMS_A0012 (metG)
Enzymes [BR:mmym01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MMS_A0012 (metG)
Amino acid related enzymes [BR:mmym01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MMS_A0012 (metG)
Transfer RNA biogenesis [BR:mmym03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MMS_A0012 (metG)
 Prokaryotic type
   Other AARSs
    MMS_A0012 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ADK69443
Position
complement(16998..18527)
Genome map
AA seq 509 aa AA seqDB search
MSKKFYITTPIYYPSGNLHLGHAYTTTLADILNRYKKEQGYETFFLTGSDEHGQKIENKA
KEANLTPLEYLNPKVQAFKDLWTKLNIDYDKFIRTTDDYHEKTVQKIFTILLEKGYIYKG
QYEGIYCVSCEEFLTNEQIDENGLCKISNTKPQLVNENTYFLKVSQFQEFVQNILKSEFL
IPEYRRNEMLKNFVEPGLKDLSITRVNFKWGIPITQDQKHIIYVWLDALSNYITALGYLQ
EDDSLFKKFWQNDDCEILQLAGKEIIRFHSIYWPVMLETLNLKQPTHLLGHGWILNKNTK
MSKSLGNIIDPVKIIELYSADALRFYIANDLPTEKDGNFSLELFIESFNAHLANNVGNLI
SRTHNMISKYFNGYIDLNNIKYDQELIDLGIKTIDNYIFNMDQYKISEAIKVVLELSNAC
NKYIEIKTPWNLEKENRIEELKTVLATLQRNIAIISYLLKPVLVNSYTDMIEQSGLENVQ
INFSDLKTFSNIKFNKLNNKKVIFNRIKE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaaattttatataaccacaccaatttattatcctagtggtaatttacatcta
ggtcatgcttatacaacaacactagctgatattttaaatagatataaaaaagaacaaggc
tatgaaactttctttttaacaggtagtgatgaacatggtcaaaagattgaaaacaaagca
aaagaagctaatctaacaccactagaatatctaaatcctaaagtacaagcttttaaagat
ttatgaactaaattaaatattgactatgataaattcattagaactacagatgattatcat
gaaaaaactgttcaaaaaatctttactattttattagaaaaaggatatatctataaagga
caatatgaaggaatatattgtgttagttgtgaagagtttttaactaatgaacaaattgat
gaaaatggattatgtaaaatttcaaacacaaaaccacaactagttaatgaaaatacttac
tttttaaaagttagtcagtttcaagaatttgtgcaaaatattttaaaatcagagttctta
attcctgaatatagaagaaatgagatgttaaaaaattttgttgaaccagggttaaaagat
ctatcaataactagagtaaattttaaatgaggaattccgattactcaagatcaaaaacat
ataatttatgtttgattagatgctttaagtaactatattacagctttaggatatcttcaa
gaagatgactcattgtttaaaaagttttgacaaaatgatgattgtgaaattttacaatta
gccggaaaagaaattattaggtttcactcaatttattgaccagtaatgttagaaacttta
aatttaaaacaacccacacatttattaggtcacggatgaattttaaacaaaaatactaaa
atgagtaaatctttaggaaatataattgatccagttaaaatcattgaattatattcagct
gatgctttaagattttatatagcaaatgatctaccaactgaaaaagatggtaattttagt
cttgaattatttattgaatcatttaatgctcatctagctaataatgtaggtaatttaata
agtagaactcataatatgattagtaaatattttaatggatatattgatttaaataatatt
aaatatgatcaagaattaattgatttaggtatcaaaacaatcgataactatatttttaat
atggatcaatataaaattagtgaagctattaaagttgttttagagttatctaatgcatgt
aataaatatattgaaattaaaacaccttgaaatttagaaaaagaaaatagaattgaagaa
ctaaaaactgtattagctactttacaaagaaatattgcaattatttcttatttactaaaa
ccagtattagttaattcatatactgatatgatagaacaatctggattagaaaatgttcaa
attaattttagtgatctaaaaactttttctaatatcaaatttaataaattaaataataaa
aaagttatttttaatagaatcaaagaataa

DBGET integrated database retrieval system