KEGG   Maritalea myrionectae: MXMO3_00012Help
Entry
MXMO3_00012       CDS       T05588                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
mmyr  Maritalea myrionectae
Pathway
mmyr00010  Glycolysis / Gluconeogenesis
mmyr00020  Citrate cycle (TCA cycle)
mmyr00620  Pyruvate metabolism
mmyr01100  Metabolic pathways
mmyr01110  Biosynthesis of secondary metabolites
mmyr01120  Microbial metabolism in diverse environments
mmyr01130  Biosynthesis of antibiotics
mmyr01200  Carbon metabolism
Module
mmyr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXMO3_00012
   00020 Citrate cycle (TCA cycle)
    MXMO3_00012
   00620 Pyruvate metabolism
    MXMO3_00012
Enzymes [BR:mmyr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     MXMO3_00012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: AVX02561
UniProt: A0A2R4M971
Position
12208..13800
Genome map
AA seq 530 aa AA seqDB search
MSTITRADVNAKIKSLAANLSFNDKAPKLVEKALARNEVELSADGAVVATTGQHTGRSAN
DKFIVDDALTHDTVWWDNAKSMTPEKFDILLSDMLASAENKDLFVQQLYAGADVSQQLNV
EVFTENAWHALFIRNLLIRPALNALSDFDANVTIVHMPSFKADPARHGTRSETVIALDFS
RNMVVIGGTFYAGEIKKSVFSLFNFHAPQNGVLPMHCSANIGEAGDTALFFGLSGTGKTT
LSTDPNRVLIGDDEHGWTADGVFNLEGGCYAKTINLSRQAEPEIFAATERFGTVLENVIL
DEETLKPDFNDGSLTENTRAAYPLTALDNVSRTGIGPVPKTVMLLTADAFGVLPPIARLT
PEQAIYHFLSGYTAKVAGTERGVTEPQATFSACFGAPFMSLHPSVYGKMLKKQIRDSLAE
CWLLNTGWTGGAYGTGKRISIKDTRTLLSAALTGELVNAEMRVDPIFGFEVPTAVDGVDP
QLLTPRATWADVDAYDAQAEKLVKLFEENFKKFGASAIELANAGPKLAAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgatcacgcgggccgacgttaacgcaaaaatcaagtcactggcggccaatctc
tcgtttaacgacaaggcgcccaaactggttgaaaaagccttggcgcgaaatgaagtagag
ctgagcgcagatggtgcggttgtggcaacaacaggtcagcatactggccgttctgccaac
gacaaattcatcgttgatgatgcgctgacccacgacacggtgtggtgggacaatgcgaaa
tccatgacgccagagaaattcgatattctattgtcagatatgctggcgagcgctgagaac
aaagatttgttcgtgcagcagctttatgccggtgctgatgtgagccagcaattgaatgtt
gaagtgttcaccgagaatgcttggcatgctctgttcatccgcaatttgttgatccgccca
gcgctaaacgcactgagcgacttcgatgccaatgtaaccattgtgcatatgccatcgttc
aaagcggacccggcacgccatggcacgcggtctgaaacagttattgcgctcgatttcagc
cgcaatatggtggtgattggcggcactttctatgctggcgaaatcaagaaatcagtattc
tccctgttcaacttccatgcgccacaaaatggcgtgttgccgatgcactgctctgccaat
attggcgaagcaggtgacactgccctgttctttggcctttccggcactggcaaaaccacg
ctttcaacagatccaaatcgggtgttgatcggcgatgatgagcatggctggactgctgat
ggcgtgtttaaccttgaaggtggttgctacgccaaaaccatcaatttgtcgcggcaagct
gaacctgaaatctttgctgctacggaacgtttcggtacggtgctggaaaatgtgattttg
gacgaagagacattgaagcctgatttcaatgacgggtccctgactgaaaacacacgggcg
gcctatccgctcaccgcgctcgacaatgtgtcgcgcaccggcattggccctgtgcccaaa
acagtgatgttgttgacggctgacgcgtttggcgttttgcctccaattgcacggctgaca
cctgagcaggcgatttatcacttcttgtctggctacaccgcaaaagtggcgggtactgag
cgtggcgttactgagccacaggccactttctccgcgtgctttggcgctccgttcatgtcg
ttgcacccaagtgtttatggcaagatgctgaagaaacaaattcgcgatagcttggcggaa
tgctggttgttgaacaccggctggaccggcggcgcctatggcacaggcaagcggatctcc
attaaagacacacgcacattgctgtctgcagcattgactggtgagttggtgaacgcagag
atgcgggttgatccgatcttcgggttcgaggtgccaacagctgtcgatggtgttgaccct
caattgctgacaccacgtgccacatgggccgatgttgacgcctatgatgcgcaagctgag
aagttggtcaaattgtttgaagaaaacttcaagaagtttggggccagcgctattgaattg
gccaatgccggaccgaaattggccgctgcataa

DBGET integrated database retrieval system