KEGG   Maritalea myrionectae: MXMO3_00066Help
Entry
MXMO3_00066       CDS       T05588                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmyr  Maritalea myrionectae
Pathway
mmyr00071  Fatty acid degradation
mmyr00072  Synthesis and degradation of ketone bodies
mmyr00280  Valine, leucine and isoleucine degradation
mmyr00310  Lysine degradation
mmyr00362  Benzoate degradation
mmyr00380  Tryptophan metabolism
mmyr00620  Pyruvate metabolism
mmyr00630  Glyoxylate and dicarboxylate metabolism
mmyr00640  Propanoate metabolism
mmyr00650  Butanoate metabolism
mmyr00900  Terpenoid backbone biosynthesis
mmyr01100  Metabolic pathways
mmyr01110  Biosynthesis of secondary metabolites
mmyr01120  Microbial metabolism in diverse environments
mmyr01130  Biosynthesis of antibiotics
mmyr01200  Carbon metabolism
mmyr01212  Fatty acid metabolism
mmyr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MXMO3_00066
   00630 Glyoxylate and dicarboxylate metabolism
    MXMO3_00066
   00640 Propanoate metabolism
    MXMO3_00066
   00650 Butanoate metabolism
    MXMO3_00066
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MXMO3_00066
   00072 Synthesis and degradation of ketone bodies
    MXMO3_00066
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MXMO3_00066
   00310 Lysine degradation
    MXMO3_00066
   00380 Tryptophan metabolism
    MXMO3_00066
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MXMO3_00066
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MXMO3_00066
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MXMO3_00066
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmyr04147]
    MXMO3_00066
Enzymes [BR:mmyr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MXMO3_00066
Exosome [BR:mmyr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MXMO3_00066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AVX02614
UniProt: A0A2R4M9L3
Position
complement(70105..71241)
Genome map
AA seq 378 aa AA seqDB search
MSNTIYMVAAKRSAVVPRGGTFAHLQPHELGAPLIKSLLDETKIAPTQIDHVLLGNGLAG
GGNVARMVALAAGLPEAVPAITLDSQCCGGVDAVQMAMHMLGAGAADIILAGGVESFSTA
PRRIKRGRDGAPDQEYHRPPFSPWPERDPDMIAAAAHLAKHKQISRTAQEEFAIKSHQKA
QAAQVDMRAEIVAIADVAEDAFTRTLSPKLCAKLPLLAGDKDTGLTAATTAVEADGAGLC
VLLSEKALNDHAELKPHAIKLRGATSVGSDPALPGLAPIAAIEKLLRQLDLSCANIAIVE
MMEAFAAQAMACLEATDLPLARTNLGGGALARGHPIGASGAINLVRLFHELQRAEIGAYG
LAAIAGAGGLGAALVMQK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacacgatctatatggtggctgctaaacgcagcgctgtggtgccacgcggcggc
acattcgcacatttgcagccgcatgaactgggcgcgccacttatcaaatccctgttggac
gaaaccaagattgcgccaacccaaatcgatcatgtgctgttgggcaatggtttggctggc
ggcggcaacgtggcgcgcatggtggcgctggccgcaggactgcccgaagccgtgcctgcc
ataacgttggacagccaatgttgcggcggcgtcgatgccgtacaaatggccatgcatatg
ctgggcgcgggggcggcagatattatattggctggcggggtggaaagcttcagcaccgcg
ccgcggcggatcaaacgcggacgtgatggcgcgccagatcaggaatatcatcgtccgcct
ttttcgccttggccagaacgtgatccggatatgattgccgcggccgcgcacttggccaaa
cacaagcaaatatcgcgcacagcgcaagaagaatttgcgataaagagtcatcaaaaggcg
caggcagcgcaggtcgatatgcgagctgaaatagtggccatagcggatgtggcggaggat
gcttttacccgtaccctttcgccaaaattgtgcgccaagctgccgcttttggccggggac
aaagacactggcttgaccgcggcaactaccgccgtggaagccgacggcgccggactttgc
gtgctgttgtcggaaaaagcacttaatgatcatgcagaactgaaacctcatgcaataaaa
ttgcgtggcgccacaagcgtcggcagcgatcctgccttgcccggccttgcgccgattgca
gccattgaaaagctattgcgccaactcgatttgtcttgtgcgaacattgccattgttgag
atgatggaagctttcgcggcgcaggccatggcttgtcttgaagcgactgatttgccgctt
gcccgcaccaatcttggcggaggtgcgttggcgcgtgggcacccgattggcgcctccggc
gcgatcaatctggtgcgtctgtttcatgaattacaacgggccgaaattggcgcttatggc
ctggccgccattgcaggtgcaggcgggttgggcgcagctttggtgatgcagaaatga

DBGET integrated database retrieval system