KEGG   Methanococcus maripaludis C7: MmarC7_0357Help
Entry
MmarC7_0357       CDS       T00553                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmz  Methanococcus maripaludis C7
Pathway
mmz00020  Citrate cycle (TCA cycle)
mmz00640  Propanoate metabolism
mmz00660  C5-Branched dibasic acid metabolism
mmz00720  Carbon fixation pathways in prokaryotes
mmz01100  Metabolic pathways
mmz01110  Biosynthesis of secondary metabolites
mmz01120  Microbial metabolism in diverse environments
mmz01130  Biosynthesis of antibiotics
mmz01200  Carbon metabolism
Module
mmz_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MmarC7_0357
   00640 Propanoate metabolism
    MmarC7_0357
   00660 C5-Branched dibasic acid metabolism
    MmarC7_0357
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC7_0357
Enzymes [BR:mmz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MmarC7_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A DUF3879
Motif
Other DBs
NCBI-ProteinID: ABR65426
UniProt: A6VG50
Position
369475..370563
Genome map
AA seq 362 aa AA seqDB search
MKLHEYEAKEIFKENGIPIPKNKLTCGKVDSIDYPVVIKAQVLVGGRGKAGGILFSDNLD
DANEKIESLIGNTVKGEVVEKVLLEEQIKISKEYYVGVVVNRNEKNNVVIFSTEGGVDIE
EVASKTPEKIIKLPLESGKEFLPYLAREMLKKAGIPSAEIPKVADVLCKVYKAFKDMDGI
LAEINPLVFTEDGKIIAADAVLNIDDDAYFRHNYDKFEEFEKQEKSEFAYVELDGDIAVI
GNGAGLTLASMDIVKEFGGEPACFLDVGGGSTRETVKKALLKATSRKNVKGAFINILGGI
TRCDEVSLGIVDVLNENPNLKFAVRMMGTNEEEGRKILSENGVSFENSMDGAAKALTELI
NS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcacgaatatgaagcaaaggaaatttttaaagaaaatggaatcccaattcca
aaaaacaaacttacttgcggtaaagtcgacagtatcgattatcctgttgttataaaagcg
caagttttagtcggtggaagaggaaaagctggcggaatcttattttcagataatttagat
gatgcaaacgaaaaaattgaatcattgataggaaacacggtaaaaggagaagtcgttgaa
aaagtactccttgaagagcagataaagatttcaaaagaatactatgttggcgttgttgtt
aatagaaatgaaaaaaacaatgttgttatattttcaaccgaaggtggagtagatattgaa
gaagtagcttcaaaaactccagaaaaaataataaaattgccgttagaatctggaaaagaa
tttttaccataccttgcaagagaaatgctcaaaaaagcaggcattccaagtgcagaaatt
ccaaaagttgcagacgttttgtgcaaagtttataaagcattcaaagatatggatggaatt
ttagctgaaataaacccgttagtgtttacagaagatggaaaaatcattgctgcggatgca
gttttaaatattgacgacgatgcatactttagacataattacgataaatttgaagaattt
gaaaaacaggaaaaatccgaatttgcatacgttgaacttgatggtgacattgcagttatc
ggaaacggtgcaggacttacccttgcaagcatggatattgtaaaagagttcggcggagaa
cctgcatgtttcttggatgttggtggtggttcgaccagagaaactgtaaaaaaagcactt
ttaaaagcaacttctagaaaaaatgttaaaggagcatttatcaatattcttggtggaatt
actagatgtgatgaagtctcattgggaattgtagacgttttaaatgaaaatccaaacctt
aaatttgcagttagaatgatgggaactaacgaagaagagggaagaaaaatcctctctgaa
aatggagtaagtttcgaaaattcaatggacggggcagcaaaagcacttacagaactaata
aatagttaa

DBGET integrated database retrieval system