KEGG   Miniopterus natalensis: 107523863Help
Entry
107523863         CDS       T05883                                 

Gene name
MARS2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mna  Miniopterus natalensis
Pathway
mna00450  Selenocompound metabolism
mna00970  Aminoacyl-tRNA biosynthesis
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107523863 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107523863 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mna01007]
    107523863 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mna03016]
    107523863 (MARS2)
Enzymes [BR:mna01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     107523863 (MARS2)
Amino acid related enzymes [BR:mna01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   107523863 (MARS2)
Transfer RNA biogenesis [BR:mna03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107523863 (MARS2)
 Prokaryotic type
   Other AARSs
    107523863 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 D123 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 107523863
NCBI-ProteinID: XP_016051028
Position
Unknown
AA seq 662 aa AA seqDB search
MSEKKKSTELGNDYLRENRKPRRKEHTKSLSSPFPPAPLPPPRTCPRGPETKLRSCGAHA
EAPPAPAADGGDARTQNPRPQAARPRLPLLEASSPRLYSSGSLGARDGAREARAYFTTPI
FYVNAAPHIGHLYSALLADALCRHRRLQAPGAGATRFSTGTDEHGLKVQQAAAAAGLAPR
ELCDRVSAQFQQLFRDSRISSTDFLRTTEARHRAAVQHFWGALKARGLLYKGLYEGWYCA
SDECFLPETKVSRQPGPSGEPCPVSVESGHPVSWTKEENYIFRLSQFREPLQRWLRDNPQ
VITPEPFQHAVLQWLEEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVIG
YPNAEFKLWWPTTSHIIGKDILKFHAIYWPALLLGAGMSPPNRIYVHSHWTVCGQKMSKS
LGNVVDPRTCLERYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGLLNRCT
ANRINPSGIYPAFCTTCFPSEPGLAGPSVRAQAEDYALVSAVATLPKQVADHYANFQIYK
ALEAVSSCVRQTNGFVQRHTPWKLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSL
ADKLLSRLGVSATERGLGELNFLPRFYGHPCPFEGRSLGPETGLLFPRLDQSRAWMVKAH
RT
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaagaaaaaaagtacagaattgggcaatgattacctccgggagaacaggaag
cccaggagaaaggaacacactaagtcactgtcctcgcccttccctccggcccctctaccc
cccccccggacgtgcccacgagggcccgagactaaactgaggagctgcggggcccacgca
gaggcgccccccgcgccggccgccgacggcggagacgcccgaacgcaaaatccccgccca
caagcagctcggccccggctgccgctcctggaggcctcgagcccgcgtctctacagttcc
ggctctctcggtgcccgcgacggagctcgcgaagcgcgcgcctacttcaccacacccatt
ttctatgtgaacgcggcgccgcacatcgggcacctgtactcggcgctgctggcggacgct
ctgtgccgccaccgtcgcctccaagctcccggcgccggcgccacgcggttctccaccggc
accgacgagcacggcctgaaggttcagcaggcagccgccgctgcgggcctggccccgcgc
gagctgtgcgaccgggtctcggcccagttccagcagcttttccgggactccagaatctcc
tccaccgacttcctccgcaccaccgaggcccggcaccgggcggcggtgcagcacttctgg
ggcgcgctgaaggcgcggggtctgctgtacaaggggctctacgaaggctggtactgcgcc
tctgacgagtgcttcctgcctgagaccaaggtcagccggcagcccggcccgtcgggggag
ccctgccctgtatctgtcgagagcgggcaccccgtctcctggaccaaggaagaaaactac
attttcaggctttcccagttccgggagccgctccagcggtggctgcgggacaacccgcag
gtgatcacccccgagcctttccagcacgctgtccttcagtggctggaggaggagctgccg
gacctgtcagtctctcgcaggagtagccacttgcactggggcattccagtgcccggggac
gattcgcagaccatctacgtatggctggatgccttggtcaactaccttactgtaattggc
tacccgaatgctgagttcaagttatggtggccgaccacctctcatatcataggcaaggac
atcctcaagttccatgctatttattggcctgctctcctcttaggggcaggcatgagccca
ccaaaccgcatctatgtccattctcactggacagtctgtggccaaaagatgtctaagagc
ttgggcaacgtcgtggatcccagaacttgccttgaacgctacactgtggatggcttccgc
tactttctcctccgtcagggtgtccccaactgggactgtgattactatgatgaaaaggtg
gttaagttgctagactctgagctggcagatgctttgggaggtctcctgaaccgatgcact
gccaataggataaatccttctggcatctacccggccttctgcactacttgctttcccagt
gagccagggttggcggggccatcagttcgtgcccaggcagaggactatgctctggtgagt
gcagtggccactttgcccaagcaggtagcagaccactatgctaactttcagatctataag
gctctggaggcagtgtccagctgtgtccggcaaactaatggctttgtccaaaggcataca
ccatggaaattgaactgggagagcccagtggatgctccctggctgggtactgtgcttcat
gtggccttggaatgtttgagagtctttggaactttgctccagcctgtcaccccaagccta
gctgacaagctgctgtccaggttgggggtttctgccacagagaggggccttggagagctc
aatttcttgcctcgattctatggacatccttgcccttttgaagggaggagtctgggacct
gaaactgggctcttgtttccacgattggaccagtccagggcctggatggtgaaagctcat
aggacctag

DBGET integrated database retrieval system