KEGG   Miniopterus natalensis: 107524621
Entry
107524621         CDS       T05883                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107524621 (ADAMTS13)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     107524621 (ADAMTS13)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   107524621 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_spondin TSP1_CCN Reprolysin_3 Reprolysin_4
Other DBs
NCBI-GeneID: 107524621
NCBI-ProteinID: XP_016052053
Position
Unknown
AA seq 1463 aa
MREIHPWGTFLWGILTSAVLLLGCWGLPDVQKGFLQALEPREVTSYSGPGATLKGPPSSR
LRRHAVEGSVLHLELLVAVGPDVYQAHQEDTERYVLTNLNMGSELLRDPSLGAQFRVHLV
KMIILTQPEDAPNITTNITSSLLSVCKWSRTVNPQDDRDPGHADLVLYITRFDLELPDGN
RQVRGVTQLGGACSSSWSCLITEDTGFDLGVTIAHEIGHRYVAPQAVPKLRPRSXPGPLG
GEVEAGSGPWTGPVLEGACALDPIYRLLNAGRARCVWDPPGPQSGPAGRPPEAHPGLYYG
ADEQCRVAFGPSAVACTFTRENLDMCQALSCHTDPLDHSSCSRLLIPLLDGTECGLEKWC
SKGHCRSLAELTPMGAVHGHWSAWGPPSPCSRSCGGGVVTRRRQCNNPRPAFGGRACVGA
DLQAKMCNTQACETTQLEFMSEQCAETEGKPLHLSPGNTSFYRWGPAVQYSQGDALCRHM
CRAVGESFIVRRGDSFQDGTRCVPSGPREDGTLSLCVLGSCRTFGCDGQMDSQQVPDVCQ
VCGGDNSTCSPQNGSFMAGRAKEYVTFLTLTPNLTSVYIANHKPLFTHLAVRIRGRYVVA
GNLSISPSTTHPSLLEDSRIEYKVTLTEDRLPRLEEIFIRGPTQEDIEIQVYRRYGEEYG
NVTRPDITFTYFQPRLRQAWVWAAVRGSCSVSCGAGLRWVTYSCLDQARSEWVEAAQCGG
SPQPAAWSESCSPGPCPPYWAAGDFGPCSASCGGGLRERAVRCMEAQGHRLRTLPPARCR
ALAQKPVVVETCNSQPCPPRWEVSDACSSACGADLAVQNVTCVQATDGPEAPVTAEPSST
DKKPTALEPCMEVLDLQPLGMEAASPSGSTRLGAPAAHVWTPLAGPCSVSCGKGHMELRF
MCMDSTLRTPVQEELCDLASKPASRREVCQAALCPAWWETRALAPCPVTCGGGQVPLAVR
CVRLDRGRYISLPHSKCWPVPQPEPLEACSPEPCPARWRYKLAACSVSCGGGVMRRILYC
ARAHGQDKEEEILPDAQCQGLPHPEQQEACSLEPCPPRWKVTSLGPCSASCGLGTATRSI
ACVQLDQGQDVEVDGAACVALVRPQASIPCVVADCTYQWHVSAWTPCSVSCGDGIQRRHD
TCLGPQARGPLPADFCQHLPKPATVRGCWAGPCAGQGTPILVPHEEATASGQTTAGPAAA
SSEWPQPWARLVSPVPQTPGLLPAPWESPVESSPCGGQHLEPTGVIDLRGPGQADCAVAI
GRPLGEVVILQVLESSLNCSTGEMLLLWGRLMWRRTCRKLSGMTFSSKANTLVVRQRRLQ
PRGGVVLRFSSRPAPGTFHRECDMQLFGPRGEITSPLMSSDGRNVGGCRIFIDVAPWARI
AIHALATDMGPGAEGTDASYILIRDIHSLKTMTFRGQRALYWESEGSQAEMELSQGFLET
QARLRGQYWTLQPRARGLRSALP
NT seq 4392 nt   +upstreamnt  +downstreamnt
atgagggagattcacccctgggggacgttcctgtggggcattctcacctctgcggtcctc
ctcctgggctgctggggactccccgatgttcagaagggatttcttcaggccttggagccc
cgggaagtgacttcttactcaggccctggtgctaccttaaaaggccctccttcctctcgc
ctccggagacacgctgtggaggggagcgtcctgcacctggagctgctggtggccgtaggc
cctgatgtctaccaggctcaccaggaggacacggagcggtacgtgctcaccaacctcaac
atggggtcggaactgctgagggacccatccctgggggctcagttccgagtgcacctggta
aagatgatcatcctcacgcagcccgaggatgctccaaacatcacaaccaacatcacctcc
tcactgttgagcgtctgcaaatggagcaggacggtcaacccccaggacgacagggacccc
gggcatgctgacctggtcctctacatcaccaggtttgacctggagttgcctgatggtaac
cggcaggttcggggagtcacccagctggggggcgcctgctcctcctcatggagctgcctc
atcactgaagacaccggcttcgacctgggggtcaccattgcccatgagattggacacagg
tatgtggccccacaagctgtccccaagctcaggccaaggagctgacctgggcccctggga
ggggaggtcgaggctggcagtgggccctggacagggcctgtgctggaaggagcctgtgcc
cttgaccccatatacagactcctgaacgcaggacgggcgcgctgcgtgtgggacccgccg
gggccgcagtccgggcccgcggggcgccctcccgaggcacacccggggctctactacggc
gcggacgagcagtgccgcgtggccttcggcccctccgcggtcgcctgcaccttcacccgg
gagaacctggacatgtgccaggctctctcctgccacacagacccgctggaccacagcagc
tgcagccgcctcctcattcccctcctggacgggacagagtgcggcctggagaagtggtgc
tccaagggtcactgccgctccctggcagagctgacccccatgggggctgtgcacgggcac
tggtcagcttggggtccccccagtccttgctcccgctcctgcggaggaggtgtggtcacc
aggaggcggcaatgcaacaaccccagacctgcctttggggggcgtgcatgcgtaggtgct
gacctccaggccaagatgtgcaacacccaggcctgcgagacgacccagctggagttcatg
tctgagcagtgtgccgagaccgaggggaagcctctgcacctctcccccggcaatacctcc
ttctaccgctggggccctgctgtgcagtacagtcaaggggatgctctgtgcagacacatg
tgccgggccgttggcgaaagcttcattgtgaggcgtggggacagtttccaggatgggacc
cgatgtgtgccaagtggccctcgggaggacgggaccctaagcctatgcgtgttgggcagc
tgcaggacattcggctgtgatggccagatggactcccagcaggtgccagatgtgtgccag
gtgtgtggaggggacaacagcacgtgcagcccacagaacggctctttcatggctggaaga
gccaaagagtatgtcacattcctgacgctcactcccaacctgaccagtgtctacattgcc
aaccacaagcctctcttcacacacctggcagtgaggatccgagggcgctacgtggtggct
gggaatttaagtatctctcccagcaccacccacccctccctcctggaggacagtcgaatt
gagtacaaagtgaccctcactgaggaccggctgccccgcctggaggagatcttcatccgg
ggacccacccaggaagacatagagatccaggtgtacaggcgctatggcgaggagtatggc
aacgtcacccgcccagacatcaccttcacctacttccagcctagactgcggcaggcctgg
gtgtgggccgccgtgcgggggtcctgctcggtgagctgtggggcagggctgcgatgggtg
acctacagctgtctggaccaggccaggagcgagtgggtggaggctgctcagtgcggaggg
agcccgcagccggcggcctggtcagaatcctgcagccctggaccctgccccccatactgg
gcagctggagacttcggcccgtgtagcgcctcctgcgggggaggcctgcgggagcgggca
gtgcgctgcatggaggcccagggccaccgtctgaggacgttgcccccggcccggtgccga
gcgctggcccagaagccagtggtggtagaaacctgtaactcccagccctgcccccccagg
tgggaggtgtcagacgcatgctcctcggcctgtggagcagacctggccgtacagaatgtc
acgtgcgtgcaggcaacagatggcccagaggcaccagtgactgctgagccctcctctaca
gacaagaaaccaactgctctcgagccctgtatggaggtgctggacctccagcctctgggg
atggaggctgcatccccatcaggcagtaccaggctgggggctcccgctgcacacgtgtgg
actcccctagcagggccgtgctccgtctcctgtggcaaaggccacatggagctgcgtttc
atgtgcatggactctaccctcaggacacctgtccaggaagagctgtgtgacctggcaagc
aagccggcgagccggcgggaggtctgtcaggctgccctatgcccggcttggtgggagacc
cgagccttggcgccatgcccagtgacctgcggagggggacaggtgccgttggctgtgcgc
tgtgtgaggttggaccgtggacgctacatctctttacctcactccaagtgctggccagtg
ccccagcccgaacccctcgaggcctgcagtccggagccctgccccgccagatggcggtac
aagctggcggcctgcagcgtgagctgtgggggaggggtcatgcggaggatcctgtattgt
gcccgggcccatgggcaggacaaagaggaggagatcctgccggatgcccagtgccagggg
ctccctcacccagagcagcaggaagcctgcagcctggagccctgcccgcccaggtggaaa
gtcacgtcccttggcccatgctcagccagctgtggcctaggcaccgccacacgctccata
gcctgcgtgcagctggaccagggccaggacgtggaggtggacggggcggcctgtgtagct
ctggtgcggccacaggccagcatcccctgcgtcgttgcagactgcacttaccagtggcac
gtcagcgcctggacgccgtgctctgtctcctgtggggatggcatccagcgccggcatgac
acctgcctgggaccccaggcccgggggcccttgccagccgacttctgccagcacttgccc
aagcctgcgactgtgcggggctgctgggccgggccctgtgcagggcaggggacacccatc
ctggtgccccatgaggaagccactgcctcaggacagaccacagctggccctgcggctgct
tcctcagagtggccccagccctgggcccgcctcgtttccccagtgccccagactccgggg
ctcctaccggcgccctgggaaagccctgtggagtccagtccctgtggcgggcagcacctt
gagccaacaggagtcattgatttgcgtggcccggggcaggctgactgtgcagtggccatt
gggcggcccctgggtgaggtggtgatcctccaagtccttgagagctccctcaactgcagc
acgggggagatgctgctgctttggggcaggctcatgtggaggaggacttgcaggaagctg
tcgggcatgactttcagctccaaagccaacacactggtggtgcggcagcgccgcctgcag
ccgcgaggcggagtggtgctgcggttttccagccggcccgcccccgggaccttccacaga
gaatgcgacatgcagctcttcggaccccggggtgaaattacaagtccactgatgagttca
gatgggagaaatgtggggggctgccgcatcttcatcgacgtggctccgtgggcccgtatc
gccatccacgctctggccaccgacatgggccctggagctgagggaactgatgccagctac
atcttgatccgggacatccacagtctgaaaacgatgacattccgcgggcagcgagcgctc
tactgggagtcggagggcagccaggccgagatggagcttagccagggctttctggaaaca
caggcccgcctgcggggccagtactggacgctgcagcccagggctcgggggctccgcagt
gccctgccctag

DBGET integrated database retrieval system