KEGG   Miniopterus natalensis: 107526019Help
Entry
107526019         CDS       T05883                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mna  Miniopterus natalensis
Pathway
mna00350  Tyrosine metabolism
mna00360  Phenylalanine metabolism
mna00380  Tryptophan metabolism
mna01100  Metabolic pathways
mna04726  Serotonergic synapse
mna04728  Dopaminergic synapse
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05034  Alcoholism
Module
mna_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
mna_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107526019 (DDC)
   00360 Phenylalanine metabolism
    107526019 (DDC)
   00380 Tryptophan metabolism
    107526019 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    107526019 (DDC)
   04726 Serotonergic synapse
    107526019 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    107526019 (DDC)
   05031 Amphetamine addiction
    107526019 (DDC)
   05034 Alcoholism
    107526019 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107526019 (DDC)
Enzymes [BR:mna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     107526019 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     107526019 (DDC)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107526019 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 107526019
NCBI-ProteinID: XP_016053819
Position
Unknown
AA seq 480 aa AA seqDB search
MDATEFRRRGREMVDYIADYIEGIEGRQVYPDVEPGYLRPLIPSCAPQEPDAYEDIMKDV
EKVIMPGVTHWHSPRFFAYFPTGSSYPAMLADMLCGAIGCIGFSWASSPACTELETVMLD
WLGKMLQLPEAFLAEKAGSGGGVIQGSASEATLMALLAARSRATRHLQATRPGLTEAAIM
EKLVAYGSDQAHCSVERAALIGGVKFKAIPSDGKFAMRASALQEVLERDKAAGLIPFFVV
ATLGTTSCCSFDRLSEVGPVCNREDLWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRVDLTGAFKLDPVYLQHSHQDSGLITDYRHWQLPLGRRFRSL
KMWFVFRMYGVKGLQAHIRKHVQLAHEFESLVRQDPRFEVCAEVTLGLVCFRLKGSNKLN
EDLLDRISSAKKIHLVPCHLRGRFVLRFAICARTVEPAHVQQAWAHIQTLASALLEAAQE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgactgagttcaggaggagagggcgggagatggtggattacatagcggactac
atcgagggcatcgagggacgccaggtctaccccgacgtggagcccggttacctgcgcccc
ctgatccccagctgtgccccccaggagccggacgcctacgaggacatcatgaaggacgtg
gagaaggtcatcatgccgggggtgacccactggcacagcccccgattcttcgcttacttc
cccacgggcagctcctacccggccatgctcgctgacatgctgtgcggggccatcggctgc
atcggcttctcctgggcctcgagccccgcgtgcacggagctggagacggtgatgctggac
tggctggggaagatgctgcagctgcccgaggcgtttctggccgagaaagctggctcgggg
ggcggggtgatccagggaagcgccagtgaggccacgctgatggccctgctggccgctcga
agcagagccacacgccacctccaggccacccgcccggggctgacggaagccgccatcatg
gagaaactggtggcctacggctcggaccaggcccactgctccgtggaaagagctgcatta
attggaggagtgaaattcaaagccatcccctcggacggcaagttcgccatgcgtgcctcg
gccctgcaggaggtgctggagagggacaaggccgcgggtctgattcctttcttcgtggtg
gcgacgctggggaccacatcctgctgctccttcgacaggctctcggaggtggggcccgtc
tgcaaccgggaggacctgtggctgcacgtggacgcggcctacgcgggcagcgccttcatc
tgccctgagttccggcatctcctgaatggcgtggagtttgcagattcctttaattttaac
ccccacaagtggcttctggtgaattttgactgctcggccatgtgggtgaagaagcgggtg
gacctgacgggagccttcaagctggaccccgtgtacctgcagcacagccaccaggactcg
ggactaatcaccgactacaggcactggcagctgccgctgggccgcaggttccgctccctg
aagatgtggtttgtcttccggatgtacggcgtcaagggactgcaggcccatatccgcaag
cacgtgcagctggcccacgagttcgagtcgttggtgaggcaggatccgcgctttgaagtc
tgtgcggaagtcactctggggctggtctgcttccggctgaagggctccaacaagctgaac
gaagaccttctggacagaataagcagtgccaaaaaaatccacctggtgccctgccacctg
agaggcaggttcgtgctgcgcttcgccatctgcgcccgcacggtggagcctgcgcacgtg
cagcaggcctgggcgcacatccagacgctggcgagcgcgctgctggaggccgcgcaggag
taa

DBGET integrated database retrieval system