KEGG   Miniopterus natalensis: 107526667
Entry
107526667         CDS       T05883                                 

Gene name
TRHDE
Definition
(RefSeq) thyrotropin-releasing hormone-degrading ectoenzyme
  KO
K01306  pyroglutamyl-peptidase II [EC:3.4.19.6]
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107526667 (TRHDE)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.6  pyroglutamyl-peptidase II
     107526667 (TRHDE)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M1
   107526667 (TRHDE)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 107526667
NCBI-ProteinID: XP_016054684
Position
Unknown
AA seq 892 aa
MGENDAALRAGGRGLSDPWADSVGVRPRTTERHITVHKRLVLAFAVSIVALLAVTMLAVL
LSLRFDDCGRDSGELVTVDIPPTTVCYAAQAEFKRQGEEGAEPLRHEEESEEKGCGILQL
DKPHAWFRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFE
EDGWVTDHFSQTPLMSTYYLAWAICNFTYRETITKSGVVVRLYARPDAIRRGSGDYALHI
TKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRILLDPSVSSISYLL
DVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLTDV
LHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQD
YLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENWI
IITQQHFIYDISAKTKALTLQNNSYRWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITY
FDKGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGY
LPQNIPLEMIRYLSAEKDFLPWHAASRALYPLDKLLDRMEKYNVFNEYILKQVATTYIKL
GWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDWISSNRNRIPLNV
RDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLNRLLNLSLNSE
VVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTE
GELKELKNFMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGKALRH
NT seq 2679 nt   +upstreamnt  +downstreamnt
atgggggagaacgacgccgcgctccgggccggcggcagggggctctcggacccgtgggca
gactccgtgggggtgagaccccgcaccaccgagcgccacatcacggtgcacaagcggctc
gtcctggccttcgccgtgtccatcgtggcgctgctcgcggtcaccatgctcgccgtgctg
ctcagcttgcgcttcgacgactgcgggcgagacagtggggaactggtcactgtggacatt
cctcctaccactgtttgttatgccgcccaagcagagttcaaaagacagggagaggaagga
gcagagccccttcgccatgaagaagagagtgaagagaaaggctgtggtattttacagctc
gacaagccccatgcttggttcagattccttggtgttactcagttttctcctacacatgcc
agaaaggcatttccttgttttgatgagcccatctacaaggcaacgtttaaaatcagcatc
aagcatcaagcaacctacttatctttatctaacatgcctgtggaaacatctgtgtttgag
gaagatggatgggttacggatcacttttcacagacccctctcatgtccacatattactta
gcctgggctatctgcaacttcacatacagagaaactatcaccaagagcggtgttgtagta
cgattatatgcaagacccgacgctatcagaagaggatctggggactatgctcttcatata
acaaagagactaatagaattctatgaggactactttaaagtgccctactccttgccaaaa
ctagatcttttagctgtgcctaagcatccgtatgctgctatggagaactggggactaagt
atttttgtggaacagagaatactgctggatcccagtgtgtcatctatttcttatttgctg
gatgtcaccatggtcattgttcatgagatatgtcaccagtggtttggtgacctcgtgact
ccagtttggtgggaagacgtgtggctgaaggaaggctttgctcactactttgaatttgtt
ggtacagactacctctacccgggctggaacatggaaaagcagcgcttcctgacggatgtt
ctgcatgaggtgatgctgctggacggcttggccagttcccatccagtgtcgcaggaagtg
ctccaggcgacagacatcgacagggtgtttgactggatcgcctataaaaagggtgctgct
ttaattagaatgctggctaattttatgggccattcagtatttcagaggggtttgcaagat
tatttaaccatccataagtatggcaatgcagccagaaatgatctctggaatacgctttcc
gaggctttaaaaaggaatggaaaatatgtaaatatacaagaagtaatggaccagtggaca
ctccagatgggttatcctgttatcaccatcttgggaaatacaacagcagaaaattggata
ataatcacccaacaacattttatttatgacatcagtgctaaaactaaagcactcacgctt
caaaataacagttaccggtggcagattccattaactattgtggtaggaaacagaagccat
gtgtcttcagaagcaattatttgggtgtcaaacaaatcagagcaccacagaataacttat
tttgacaaaggaagctggttgcttgggaacatcaatcaaactggctattttcgagtcaac
tatgatttaaggaattggagattattaattgatcaattaatcaggaaccatgaggttctc
tctgtcagtaatcgagccggtttgatcgacgatgccttcagcctggccagagctggctat
ttgcctcagaatattcccctggagatgatcagatacctgtctgcggagaaagattttctt
ccttggcacgcagccagccgagctctttacccgctggataaattactggaccgcatggag
aaatacaatgtcttcaatgaatatattttaaagcaagttgcaacaacgtacatcaagctt
ggatggccaaaaaacaattttaatggatctcttgttcaagcgtcctaccaacatgaagaa
ctacgccgagaagttataatgctggcctgcagttttggcaacaagcactgtcaccaacag
gcatcaacacttatttcagattggatttccagcaacaggaacagaataccactaaatgtt
agagacatcgtctactgtacaggagtttcactgctcgatgaggacgtctgggagttcata
tggatgaaattccactccaccacggcagtttccgagaagaaaatattattggaagcctta
acttgcagtgatgacaggaatttattaaatagacttctgaatctgtcactgaattctgag
gtggtgctggatcaagatgccattgacgtgataatccatgtagctcgaaatccacatggc
cgggaccttgcctggaagttctttagagataagtggaagatattaaataccaggtatgga
gaggcattatttatgaattccaaacttatcagtggagttacagaatttctcaatactgaa
ggtgaactcaaagagctaaagaacttcatgaagaactatgatggagtagctgctgcctct
ttctcaagagccgtggaaactgttgaagccaatgtgcgctggaaaatgctttaccaagac
gagcttttccaatggttaggaaaagctctgagacactag

DBGET integrated database retrieval system