KEGG   Miniopterus natalensis: 107527118Help
Entry
107527118         CDS       T05883                                 

Gene name
QDPR
Definition
(RefSeq) dihydropteridine reductase isoform X1
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
mna  Miniopterus natalensis
Pathway
mna00790  Folate biosynthesis
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107527118 (QDPR)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     107527118 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2
Motif
Other DBs
NCBI-GeneID: 107527118
NCBI-ProteinID: XP_016055244
Position
Unknown
AA seq 217 aa AA seqDB search
MLCSSKFVWVASIDVVENDDASASVVVKMTDSFTEQADQVTAAVGKLLGEEKVDAILCVA
GGWAGGNAKSKSLFKNCDLMWKQSMWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGM
IAYGMAKGAVHQLCQSLAGKNSGMPPGSAAIAVLPITLDTPMNRKSMPEADFSSWTPLDF
LVETFHDWITEKNRPSSGSLIQVVTTEGKTELTPAYF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgttcttcaaagtttgtgtgggtggccagcatcgacgtggtagagaatgatgat
gccagtgccagcgtcgtcgtcaaaatgacagactcgttcaccgagcaggctgaccaggtg
acggctgcggtcggcaagctcctgggtgaagagaaggtggatgcgatcctttgcgtggcc
ggaggatgggctgggggcaacgccaagtccaagtctctctttaaaaactgtgacctgatg
tggaagcagagcatgtggacgtccaccatctccagccacctggccaccaagcacctcaag
gaaggaggcctcctgaccttggccggtgccaaggctgccctggatgggactcctgggatg
atcgcctacggcatggccaagggcgccgtccatcagctgtgccagagcctcgcggggaag
aacagtggcatgccgcccgggtctgccgccatcgccgtgctcccgattaccctggacacc
ccgatgaacaggaagtccatgcccgaggccgatttcagctcctggacgcccttggatttc
ctcgtggaaaccttccacgactggatcacagagaaaaaccgaccaagctcagggagcctg
atccaagtggtgacgacagagggaaagacggaacttaccccggcatatttttaa

DBGET integrated database retrieval system