KEGG   Miniopterus natalensis: 107528155
Entry
107528155         CDS       T05883                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
mna  Miniopterus natalensis
Pathway
mna04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107528155 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107528155 (ASIC1)
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   107528155 (ASIC1)
SSDB
Motif
Pfam: ASC EFP
Other DBs
NCBI-GeneID: 107528155
NCBI-ProteinID: XP_016056566
Position
Unknown
AA seq 526 aa
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFNYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCQFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPLLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDFF
DSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCV
CEMPCNLTRYAKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQ
KKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADK
GVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggaactgaaggctgaggaggaagaggtgggtggcgtccagccggtgagcatccaggcc
ttcgccagcagctccacgctgcatggcctggcccacatcttctcctacgagcggctgtca
ctaaagcgggcgctctgggccctgtgcttcctgggctccctggccgtgctgctgtgtgtg
tgcaccgagcgtgtgcagtactacttcaactaccaccacgtcaccaagctcgacgaggtg
gctgcctcccagctcacctttcctgctgtcacgctgtgcaacctcaatgagttccgtttt
agccaagtctccaagaatgacctgtaccatgctggggagctcctggccctgctcaacaac
aggtatgagataccggacacacagatggcagatgaaaagcagctggagatactgcaggac
aaggctaacttccgcagcttcaagcccaagcccttcaacatgcgcgagttctacgaccgc
gccgggcacgacattcgagacatgctgctctcctgccagttccggggggaggtctgcagc
gcagaagacttcaaggtggtcttcacacggtatggaaagtgctacacgttcaactctggc
cgagatgggcgtccactgctgaagaccatgaagggtgggacgggcaatgggctggagatc
atgctagacatccagcaggatgagtacctgcctgtatggggggagactgacgagacgtcc
ttcgaagctggtatcaaagtgcagatccacagtcaagacgaacctcccttcatcgaccag
ctgggctttggcgtggccccagggttccagacctttgtggcctgccaggagcagcggctc
atctaccttccccctccctggggcacctgcaaagctgttaccatggactcggatttcttc
gactcctacagcattaccgcctgccgcatcgactgtgagacccgctacctggtggagaac
tgcaactgccgcatggtgcacatgccaggggacgccccatactgcactccagagcagtac
aaggagtgtgcggatcctgctctggacttcctggtggagaaggaccaggagtactgtgtg
tgtgaaatgccctgcaatctgacccgctatgccaaggagctgtccatggtcaagatcccc
agcaaagcatcagccaagtacctggccaagaagttcaacaagtctgagcagtacataggg
gagaacatcctggtgctggacattttctttgaagtcctcaactatgagaccattgaacag
aagaaggcctatgagattgcagggctcctgggtgacattgggggccagatggggctgttc
atcggggccagcatcctcacagtgctggagctctttgactacgcctacgaggtcattaag
cacaagctgtgcagacgagggaagtgccagaaggaggccaaaaggagcagcgcagacaag
ggcgtggccctcagcctggatgacgtcaaacgacacaacccgtgcgagagcctgcggggc
catcctgctgggatgacatacgctgccaacatcctacctcaccatccggcccgaggcact
tttgaggactttacctgctga

DBGET integrated database retrieval system