KEGG   Miniopterus natalensis: 107529028
Entry
107529028         CDS       T05883                                 

Gene name
NPEPPS
Definition
(RefSeq) puromycin-sensitive aminopeptidase isoform X1
  KO
K08776  puromycin-sensitive aminopeptidase [EC:3.4.11.-]
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107529028 (NPEPPS)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107529028 (NPEPPS)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M1
   107529028 (NPEPPS)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 107529028
NCBI-ProteinID: XP_016057794
Position
Unknown
AA seq 825 aa
MNCADIDIITASYVPEGDEEIHATGFNYQNEDEKVTLSFPSTLQPGTGTLKIDFVGELND
KMKGFYRSKYTTPSGEVRYAAVTQFEATDARRAFPCWDEPAIKATFDISLVVPKDRVALS
NMNVIDRKPYPDDENVVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGK
AEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLID
SKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYD
IWTQFVSADYTRAQELDALDNSHPIEVSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGD
KDFKKGMNMYLTKFQQKNAATEDLWECLESASGKPIAAVMNTWTKQMGFPLIYVEAEQVE
DDRLLKLSQRKFCASGPYVGEDCPQWMVPITISTSEDPSHAKLKILMDKPEMNVVLKNVK
PDQWVKLNLGTVGFYRTQYSSAMLESLLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTV
EVLKVMEAFVNEPNYTVWSDLSCNLGILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDP
KPGEGHLDALLRGLVLGKLGKAGHKATLEEARRRFKDHVEGKQILSADLRSPVYLTVLKH
GDGTTLDVMIKLHKQADMQEEKNRIERVLGATLSPELIQKVLTFALSEEVRPQDTVSVIG
GVAGGSKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFES
HPAPSAERTVQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgaattgtgctgatattgacattattacagcttcatatgtaccagagggagatgaagaa
atacatgctacaggatttaactatcagaatgaagatgaaaaagtcaccttgtcttttcct
agtactctccaaccaggtacaggaaccttaaagatagattttgttggagagctgaatgac
aaaatgaaaggtttctatagaagtaaatatactaccccttctggagaggtacgctatgct
gctgttacacagttcgaggctactgatgctcggagggcatttccttgctgggatgaacct
gccatcaaagccacttttgatatctcgttggttgttcctaaagacagagtagctttatca
aacatgaatgtaattgatcggaaaccatatcctgatgatgaaaatgtagtggaagtgaag
tttgcccgcacacctgtcatgtcaacgtatctggtggcatttgtagtgggtgaatatgac
tttgtagaaacaaggtcaaaagatggtgtgtgtgtccgtgtttacacccctgttggcaaa
gcagagcaaggaaaatttgcgttagaggttgctgctaaaaccctgcctttttataaggac
tacttcaatgttccttatcctctacctaaaatcgatctcattgctattgcagactttgca
gctggtgccatggagaactggggccttgttacttatagggagactgcattgcttattgat
tcaaaaaactcctgttcttcatcacgccagtgggttgctctggttgtgggacatgagctc
gcccatcaatggtttggaaatcttgttactatggaatggtggacacatctttggttaaat
gaaggctttgcatcctggattgaatatctgtgtgtagaccactgcttcccagagtatgat
atctggactcagtttgtttctgctgattatacccgtgcccaggagcttgatgccttagat
aacagccatcctattgaagtcagtgtgggccatccttctgaagttgatgagatatttgat
gctatatcatatagcaaaggtgcatctgtcatccgaatgctacatgactacattggggat
aaggactttaagaaaggaatgaacatgtatttgaccaagttccagcaaaagaatgctgcc
acagaggacctctgggaatgtttagaaagtgccagtggtaagcctatagcagcagtgatg
aatacctggaccaaacaaatgggattccccctcatttatgtggaagcagaacaggtagaa
gatgacagattactgaagttgtcccaaaggaagttctgtgccagtggaccatatgttgga
gaagactgtccccagtggatggttcctatcacaatctctactagtgaagatcccagccat
gccaaactgaaaattctaatggacaagccagagatgaatgtggttttgaagaatgtcaaa
ccagaccaatgggtaaagttaaatctgggaacagttgggttttatcggacccagtacagc
tcagccatgctggaaagtttattaccaggcattcgtgacctttctctgccccctgtggat
cgacttggattacagaatgacctcttctccttggctcgagctggaatcattagcactgta
gaggttctaaaagtcatggaggcttttgtgaatgagcccaattatactgtatggagcgac
ctgagctgtaacctggggattctctcaactctcttgtcccacacagacttctatgaggaa
atccaggagtttgtgaaagatgtcttttcacctataggggagagactgggctgggacccc
aaacctggagaaggtcatctagatgcactcctaaggggcttggtcctgggcaaactagga
aaagcaggacataaggcaacgttagaagaagcccgtcgtcggtttaaggaccatgtggaa
gggaaacagattctctccgctgatctgaggagtcctgtctatctgactgttttgaagcat
ggtgatggcactactttagacgttatgataaagcttcacaagcaagcagatatgcaggaa
gagaaaaaccgaattgaaagagtccttggggctactctttcacctgaattgattcaaaaa
gtcctcacgtttgcactttcagaagaggtacgtccacaggacactgtatcagtaattggt
ggagtggctggaggcagcaagcatggaaggaaggctgcttggaaatttataaaggacaac
tgggaagaactttataatcgataccagggaggattcttaatatccagactaataaagcta
tcagttgagggatttgcagttgataaaatggctggagaggttaaggctttcttcgagagt
cacccagctccttcagctgagcgtaccgtccagcagtgttgcgaaaatatcctgctgaat
gctgcttggctcaagcgagatgctgagagcatccaccagtacctccttcagcgaaaggcc
tcaccacccacagtgtga

DBGET integrated database retrieval system