KEGG   Miniopterus natalensis: 107529207
Entry
107529207         CDS       T05883                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107529207 (ANKRD53)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    107529207 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3
Other DBs
NCBI-GeneID: 107529207
NCBI-ProteinID: XP_016057986
Position
Unknown
AA seq 528 aa
MSSLHPRLEGCALGIQRCHSVTGSWERRGTQAPPTTPASLKLADKVSWKKFFWSNSESML
PGDSLAHVGLGPAAASSISPSSLPHPRADSSDKRNQGAIGSYSEWFAAALGNLKWLRFCL
DPDLEEIPTDNKGFSAIHFAAQSCQLECLQVLVEEYKFPVDLPTNNGQTPLHLVIHKENK
NMVLPCIHYLLEHGASLNTQTCKGSTPLHLAAREGLLSCVKVLVKSGANVHAQDAMGCKP
IDYCKIWNRRICARFLKDAMWKRDKKDFACEMGKLKRLKGQLALMEQGHLTECQKEHQML
KEADFKKWLHHKLLPRGQSLIHNTKQESRAPPWAISLSKIPKPPKSFHPFPLVHLQQTPQ
PAPQPLGAFTPIYEQHRVRQPKSWNPNNNPARSPTTQISYPQGIRLGVHPDPSSEHDFCR
FLKIRSDGHGGAQLRTVTGNQVAPVPRLPLEVIVRELYPQVRPCRMKVPQGLHSVSIRDI
DRKRYLGDNTFWTDTLAMSLRETFDEAFLAAVRAHQGLPILPSPQPPP
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgagctcgctgcaccctcggctggagggctgcgcgctggggattcagcggtgccactcg
gtgaccgggagctgggagaggaggggcacgcaggccccgcccacaacgcccgcctccttg
aagctggcagacaaagtctcctggaagaagttcttctggagcaactccgagtccatgctg
cccggtgacagcctggcccacgtgggactgggacctgccgctgcttcctccatctctcct
tcctccctcccccacccccgcgctgactccagcgataagaggaaccagggggcgattggc
agctattccgagtggttcgctgccgccttgggcaacctgaaatggttgcggttctgtctg
gatccggaccttgaggaaatccctaccgataacaagggtttctctgccatccactttgca
gcccaaagctgccagctagaatgcctgcaggtcttggtagaggagtacaagtttcccgtg
gacctgcccaccaacaatggccagacaccactgcacctcgtcatccacaaggaaaacaag
aacatggtcctcccctgcattcactatcttctggagcacggggcgtccctcaacactcag
acatgcaagggctccacaccgctgcacctggcagcccgggaggggctgctgagctgtgtg
aaggtcctggtgaagagtggtgccaatgtccatgcccaagatgccatgggctgcaagccc
atcgactattgcaaaatatggaaccgccgcatctgtgctcggttcttgaaggatgccatg
tggaaacgggacaagaaggactttgcctgtgagatggggaaactgaagaggctcaaagga
cagctggccctcatggagcagggccacctgactgagtgtcaaaaagaacaccaaatgctg
aaagaggctgatttcaagaagtggctccatcacaagctactgccccgaggccaatctctg
atccacaacactaagcaagagtcccgagccccaccctgggccatctccctctccaagatc
cccaagcctcccaagagcttccaccccttcccactggtgcacctgcaacagacaccacag
cccgcgccgcagcccttgggggcattcacacccatctacgagcagcacagagtcaggcag
cccaagtcgtggaatcctaacaacaacccggccagatcccccaccacccagatcagctac
ccgcagggcatccgcctgggtgtgcatccagaccccagctccgagcatgacttctgcaga
ttcctcaagatcaggtctgatgggcatggtggtgcgcagttgcgcacggtgactggcaac
caggtggcacctgtgcctcggctgcctttggaggtgatagtccgggagctgtaccctcag
gtgcggccgtgtaggatgaaggtgccccagggcctccactctgtcagcataagggacata
gatcggaagaggtacttgggcgacaacaccttctggacagacactctagccatgagcctg
cgtgagacatttgacgaagccttcctggcagcagtgcgagctcatcaagggctccccatt
ctgccctccccccaaccccccccataa

DBGET integrated database retrieval system