KEGG   Miniopterus natalensis: 107529804Help
Entry
107529804         CDS       T05883                                 

Gene name
PLK4
Definition
(RefSeq) serine/threonine-protein kinase PLK4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
mna  Miniopterus natalensis
Pathway
mna04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107529804 (PLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107529804 (PLK4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107529804 (PLK4)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     107529804 (PLK4)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   107529804 (PLK4)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107529804 (PLK4)
   Centrosome duplication proteins
    Regulators of centriole replication
     107529804 (PLK4)
  Sister chromatid separation proteins
   Polo kinases
    107529804 (PLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 POLO_box Pkinase_fungal Haspin_kinase Kinase-like DUF4520 Kdo
Motif
Other DBs
NCBI-GeneID: 107529804
NCBI-ProteinID: XP_016058812
Position
Unknown
AA seq 963 aa AA seqDB search
MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNE
VKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRRKPFSEKEARHFMHQI
ITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISP
EIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPTFLSREAKD
LIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSGHATISTAMTASSST
SISGSLFDRRRILIGQPLPNKMTVFPKNKNSSDFSSGDGSSFYTHWGNQEQETSYSGRGR
VIHDAEERPHSRYLRRAHSSDRSGTSNSQSRTNTHTMERCHSVEMLSRSKRSGGDENEER
YSPTNSNVNIFHFKEKTSNSSGSLERPDNNQALSNHHCPGKTPFPFPDQTSQLEMVQQWF
GNLQKIAHLRETTEHNNISPKRDFQGHPDLQDMSRNAWTDVRGRKSPEASDNAHSAKQLN
TMKYMTAFPNKPEIIPQECIFGIEPVSEQYKTKGMEPPLGYQKRTLRSITSPLTAYRLKP
IRQKTKKAVVSILDSEEVCVELLKEHSSQEYVKEVLHVSSDGNTITIYYPNDGRGFPLAD
RPPSLTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTKYAKCVLMENSPYA
DFEVWFYDGAKIHKTEALIHVIEKTGKSFTLKGESEVNSLKEEIKMYMAHANEGHRICLA
LESIISEEEKKSGSAPFFPIIIGRKPSSNSSPQALSPPPPMDPNYLMSKMTITSAASPEQ
APALNPSMVIDEGLGRTAAASGTSIPSSSLKDCLPKSAQLLKSVFVKNVGWATQLTSGAV
WVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPEYIKQKLQCLSSILLMFSNPTH
SFH
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgcatcggggagaagatcgaggattttaaagttggaaatctgcttggtaaa
ggatcatttgctggtgtctacagagctgagtccattcacactggtttggaagttgcaatc
aaaatgatagataagaaagccatgtacaaagctggaatggtacagagagtccaaaatgag
gtgaaaatacattgccaattgaaacatccttctatcttggagctgtataactattttgaa
gatagcaattatgtttacttagtattagaaatgtgccataatggagaaatgaacaggtat
ctaaagaacagaaggaaaccattctcagaaaaggaagctcgacacttcatgcaccagatc
atcacaggaatgttgtatctccattctcatggtatattacaccgggacctcacactttct
aacctcttacttacacgtaatatgaacatcaagattgctgattttgggctggcaactcaa
ttgaaaatgccccatgaaaagcactatacgttatgtggaacccctaattacatttcacca
gaaattgcaactcgaagtgcacatggacttgaatctgacatttggtcgttgggctgtatg
ttttatacgttacttattgggagaccaccttttgacactgatacagtcaagaacacatta
aataaagtagtactggcagattatgaaatgccaacttttttgtcaagagaggccaaggac
cttattcatcagttacttcgtagaaacccagcagatcgtttaagtctgtcttcagtatta
gaccatccttttatgtcccgaaattcttcaacaaaaagtaaggatttaggaaccgtagaa
gactcaattgatagtggacatgccacaatttctactgcaatgacggcttcctccagtacc
agtataagtggtagtttatttgacagaagaagaattttgattggtcagcctctcccaaat
aaaatgactgtatttccaaagaataaaaattcaagtgatttttcttcaggagatggaagc
agtttttatacccattggggaaatcaagaacaagaaaccagttatagtggaaggggaaga
gtaatccatgatgcagaagaaaggccacattctcgataccttcgtagagcccattcctct
gatagatctggcacttctaatagtcaatctcgaacaaacacacatacaatggaacgatgt
cactcggtggaaatgctttcaagatccaaaagatcaggaggagatgaaaatgaagaaaga
tactcacctacaaacagcaatgtcaatatttttcacttcaaagaaaagacatccaatagc
tctggatctttggaaagacctgataacaatcaagcactctccaatcatcattgtccagga
aaaactccttttccatttccagaccagacatctcagcttgaaatggtgcagcagtggttt
ggaaatctgcaaaaaattgctcatttaagagaaactactgagcacaacaacattagccca
aaaagagatttccagggccatccagatttgcaggacatgtcaagaaatgcctggactgat
gtaagaggcagaaagagccctgaggcttctgataatgctcattctgcaaaacagctgaac
accatgaaatatatgactgcatttcctaataaacctgagataattccacaagaatgtatt
ttcggcatagaacctgtttctgaacaatataagacgaagggtatggagccaccattgggt
tatcagaaacgtacattacgaagcattacatctcctttgacagcttacaggttaaaacca
atcagacagaaaaccaaaaaggccgtggtaagcatacttgattcagaggaggtatgtgtg
gagcttttaaaggagcattcatctcaagaatatgtgaaagaagttcttcatgtatctagt
gatggaaatacgatcactatttattatccaaatgatggaagaggttttcctcttgctgat
agaccgccttcgcttactgacaatatcagtaggtatagctttgacaatttaccagaaaag
tactggcgaaaataccaatatgcttccagatttgtacaacttgtaagatctaaatctcca
aaaatcacttattttacaaaatacgctaaatgtgttttaatggagaattccccttatgct
gattttgaggtttggttttatgatggagcaaagatacataaaacagaagcattaattcat
gtgattgaaaagactgggaaatctttcaccttaaaaggtgaaagtgaagttaatagtttg
aaagaggaaataaaaatgtatatggcccatgctaatgagggccatcgtatttgtttagca
ctggaatccataatttcagaggaggaaaagaaaagtggaagtgctcccttcttcccaata
atcataggaagaaaacctagtagtaatagctcgcctcaggccttgtcacctcctcctcct
atggatccaaactacctgatgagtaaaatgaccataactagtgctgcttctccggaacag
gcaccagcacttaatccttctatggttatagatgaaggacttggccgtactgctgcagct
tctggaacaagcatcccttctagtagtctaaaagattgtcttcctaaatcagcacagctt
ttgaagtctgtttttgtgaaaaatgttggttgggctacacagttaactagtggagctgtg
tgggttcagtttaatgatggatcccagctggttgtgcaggcaggagtgtcttctataagt
tacacatcaccaaatggtcaaacgactagatatggagaaaatgaaaaattaccagaatac
atcaaacagaaattacagtgtctttcttccatccttttgatgttttctaatccaactcac
agttttcactga

DBGET integrated database retrieval system