KEGG   Miniopterus natalensis: 107530022
Entry
107530022         CDS       T05883                                 

Gene name
RNPEPL1
Definition
(RefSeq) arginyl aminopeptidase-like 1
  KO
K09605  arginyl aminopeptidase-like 1 [EC:3.4.11.-]
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107530022 (RNPEPL1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107530022 (RNPEPL1)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M1
   107530022 (RNPEPL1)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C DUF2268
Other DBs
NCBI-GeneID: 107530022
NCBI-ProteinID: XP_016059103
Position
Unknown
AA seq 492 aa
MSATQSTYVEEEGVYHFHMEHPVPAYLVALVAGDLQPADIGPRSRVWAEPCLLPMATSKL
SGAVEQWLSAAERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTFVISSILECDEFLVIDV
IHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRITTETYGAAFTCLETAFRLDALHRQM
KLLGEDSPVSKLQVKLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGDPQRFDDFLRAYVE
KYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQGSSLTR
PVEALFQLWTAEPLDQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVVTSLSKCYS
SLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFAL
EVFYQTQGRLHPNLRRTIQQILTQGLGPGTEPSMEQGGAGADSEVDTDTPALLLGDEAPG
SAISLRDVNVSA
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgagtgccacccagagcacctacgtggaggaggagggggtctaccacttccacatggag
caccccgtgcccgcctaccttgtggccttggtggccggggacctgcagccagcggacatc
gggcccaggagccgagtgtgggccgagccgtgcctcctgcccatggccaccagcaagctg
tcgggcgctgtggagcagtggctgagcgcggccgagcggctgtacgggccatacatgtgg
ggcaggtacgacatcgtcttccttcccccctccttccccatcgtggccatggagaacccc
tgcctcaccttcgtcatctcctccatcctggagtgtgacgagttcctggtcatcgatgtc
atccacgaagtggcccacagctggtttggcaacgccgtcaccaatgccacgtgggaggag
atgtggctgagcgaaggcctggccacgtatgcccagcgccgcatcaccacggagacctac
ggtgctgccttcacctgcctggagacggccttccgcctggatgccctgcacaggcagatg
aagctcctcggagaggacagcccagtcagcaagctgcaggtcaagttggagccaggggtg
aacccgagccacctgatgaacctgttcacctatgagaagggctactgcttcgtctactat
ctgtcccagctctgtggggacccccagcgcttcgacgacttccttcgagcctacgtggag
aagtacaagttcaccagcgtggtggcccaggatctgctggactcctttctgagtttcttc
cccgagctgaaggagcagagtgtggactgccgggcagggctggagttcgagcgctggctc
aatgccactggcccgcccctggccgagccggacctgtctcagggatccagcctgacccgg
cccgtggaggccctcttccagctgtggaccgcggagcccctggaccaggcagccgcctcg
gccagcgccatcgacatctccaagtggaggaccttccagacggcactcttcctggaccgg
cttctggatgggtccccactgccccaggaggtggtgaccagcctgtccaagtgctactcc
tccctgctggactccatgaatgccgagatccgcatccgctggctgcagattgtggtccga
aatgactactaccccgacctccaccgggtccggcgcttcctcgagagccagatgtcccgc
atgtacaccatcccgctgtatgaggacctctgcactggtgccctcaagtcttttgccctg
gaggtcttctaccagacgcagggccggctgcaccccaacttgcgcaggaccattcagcag
attctgacccagggcctgggccccggcacggagcccagcatggagcagggcggtgccgga
gcagactctgaggtggacacagacacgcccgccctgctgctcggggacgaggccccgggc
agcgccatctctctcagggacgtcaacgtgtccgcctag

DBGET integrated database retrieval system