KEGG   Miniopterus natalensis: 107531147Help
Entry
107531147         CDS       T05883                                 

Gene name
DARS
Definition
(RefSeq) aspartate--tRNA ligase, cytoplasmic isoform X1
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mna  Miniopterus natalensis
Pathway
mna00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107531147 (DARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mna01007]
    107531147 (DARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mna03016]
    107531147 (DARS)
Enzymes [BR:mna01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     107531147 (DARS)
Amino acid related enzymes [BR:mna01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   107531147 (DARS)
Transfer RNA biogenesis [BR:mna03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107531147 (DARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d S-AdoMet_synt_N
Motif
Other DBs
NCBI-GeneID: 107531147
NCBI-ProteinID: XP_016060622
Position
Unknown
AA seq 499 aa AA seqDB search
MPSASRKTQEKPREVMDAAEDYAKERYGVSSMIQSQEKSDRVLVRVNDLTVQKADEVVWV
RARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVVRK
VNQKIGSCTQQDVELHVQKIYVISLAEPRLPLQLDDAIRPEVEGEEEGRATVNQDTRLDN
RVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKN
NAYLAQSPQLYKQMCICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYHEV
VEEIADTLVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGIEM
GDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNSKQSNSYDMFMRG
EEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLFLG
LHNIRQTSMFPRDPKRLTP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcgccagccgcaagactcaggagaagccgcgggaggtcatggatgcggcggaa
gattatgctaaagaaagatatggagtatcttcaatgatacagtcacaggagaaatcagat
cgagttttggtacgggttaacgatttgacagtacaaaaagctgatgaagttgtttgggtg
cgtgcaagagttcatacaagcagagctaaagggaagcagtgtttcttagtcctacgtcag
cagcagttcaatgtccaggctcttgtggcagtgggagaccatgcaagcaagcagatggtt
aaatttgctgccaacatcaacaaagagagcatcgtagatgtagaaggtgttgtgagaaaa
gtgaatcagaaaattggaagctgtacgcagcaagatgtagagttacatgttcaaaagatt
tatgtgatcagtttggctgaaccccgtttgcccctgcagctggatgatgccattcggcct
gaggtggaaggagaagaggaaggaagagctactgttaaccaagatacaagattagacaac
agagtcattgatcttaggacatcaactagtcaggcagtctttcgtcttcagtctggcatc
tgccatcttttccgagaaactttaattaacaaaggttttgtggagattcagactcctaaa
attatctcagctgccagtgaaggaggagccaatgtatttactgtgtcatatttcaaaaat
aatgcgtatctggctcagtccccacagctgtacaagcagatgtgtatttgtgctgatttt
gaaaaggttttctgtattggaccagtattcagagctgaagactctaatacccacagacat
ctaactgaatttgtcggtttggacattgaaatggcttttaattaccattaccatgaagtt
gtggaagaaattgctgacaccttagtacagatattcaaaggacttcaagaaaggtttcaa
actgaaattcagacagtgaataaacaattcccatgtgagccattcaaatttttggagccc
actttaagactagagtattgtgaagcattggctatgcttagggaagctggaattgaaatg
ggagacgaagaagacctgagtacaccaaatgaaaaactgttgggtcgtttagtaaaggaa
aagtatgatacagatttttatattcttgataaatatccattggctgtaagacctttctat
accatgcctgacccaagaaattctaaacagtccaactcttatgacatgttcatgagagga
gaagaaatactgtcaggagctcaaagaatacatgatcctcagctgttaacagagagagcc
ttacatcatggaattgatttggagaaaattaaggcatacattgattccttccgctttgga
gctcctcctcatgctggtggaggcattgggttggaacgagtgaccatgctgtttttggga
ttgcacaatattcgtcagacctcaatgttcccccgtgatcccaaacgactcactccttaa

DBGET integrated database retrieval system