KEGG   Miniopterus natalensis: 107531235Help
Entry
107531235         CDS       T05883                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04020  Calcium signaling pathway
mna04713  Circadian entrainment
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04929  GnRH secretion
mna04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107531235 (CACNA1I)
   04020 Calcium signaling pathway
    107531235 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107531235 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    107531235 (CACNA1I)
   04927 Cortisol synthesis and secretion
    107531235 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107531235 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107531235 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107531235 (CACNA1I)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107531235 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 107531235
NCBI-ProteinID: XP_016060755
Position
Unknown
AA seq 2013 aa AA seqDB search
MAESSSPLSSSAVALAPEPGVTEQPGPRSPPPSPPGLEEPPEGADPDVPHPDLAPVAFFC
LRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSERCKILQVFDDF
IFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVR
VLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFL
EENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVY
DFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVE
IMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLS
SSTVASYAEPGDCYEEIFQYVCHILRKAKRRTLGLYQTLQSQRQALGPGGPTSAKPGPHA
KEPRHFKPCPRHNPLDPAPHTLVQPISAMLASDPSSCPHCQHKVGHRPSGLGSTDSGQEG
SGSGSGGSGGGEGEAGGDGARSSEDGASSGLEKDEEEQADGAARLCGDLWRETRAKLRGI
VDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNVLEICNVVFTSMFALEMLLKLAAFGL
FDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLM
KTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDSGDTIPDRKNFDSLLWAIVTVFQ
ILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYS
EEDQSLSNAEEFEKLQEGLDSGGDPKLYPIPLTPNGHLDLSLPLGGHLGPTGTVAPARLS
LQPDPMLVALGSRKSSVMSLGRVSYDQRSLSSTRSSYYGPWGRSGAWASRRSSWNSLKHK
PPCAEHESLLSAERSGGSGGGARACEGAGDEGPPRAVPLHIQHAHHAHHGPHPMHRHHHH
RRTLSLDTRDSVDLAELGPAVGPHPRAAWRTVGMVPGHEDCNGRMPSIAKEVFTEMGDRQ
DDGDDEGEVDYTLCFRVRKMIDVYKPDWCEVRENWSVYLFSPENRFRVLCQTIIAHKLFD
YVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQ
AYLRSSWNVLDGFLVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLK
LVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAAN
YRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVPNHNPWMLLYFIS
FLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATY
CPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYLFTTVFVLE
AVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIA
RVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCE
GMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSF
VLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAQGLGPGPRLPTGSPGVPG
RGPGGPGGGGDPEGRLCPHCYSPAQENLWLDSVSLIIKDSLDGELTIIDNLSGSIFHHYS
SPAGCRKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDLTACPLRPKDSKGESDP
PEPVRVGDLGECFFPLSNTAVSLGPENFLCEMEAVSFNPVRSWLKHESSQAPSSPFSPEA
SSPLLPMPAEFFHPAVSSSQKGQEKGAGAGTLPKIALQGSWASLRSPSVNCTLLRQATGS
DTSLEASRSSSAGSLQTTLEDSLTLSDSPRRAL
NT seq 6039 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagctcctcgccgctctcctcttctgcagtggccctggcccctgagccagga
gtcacagagcagccggggccccggagcccccctccttcccctccaggcctggaggagccc
ccggagggagccgatccagatgtcccccacccggacctggcgcccgttgccttcttctgt
ctgcgacagaccaccagcccccggaactggtgtatcaagatggtgtgtaacccatggttc
gagtgtgtcagcatgctggtgatcttgctaaattgcgtgacacttggcatgtaccagccc
tgcgacgacatggactgcctgtcagagcgctgcaagatcctgcaggtcttcgatgatttc
atcttcatcttctttgccatggagatggtgctcaagatggtagcgctgggcatttttggc
aagaagtgctaccttggggacacatggaaccgactggattttttcattgtcatggctggg
atggtggagtactcgctggaccttcagaacatcaacctgtcggccatccgcaccgtgcgt
gtcctgaggcccctcaaagccatcaaccgtgtgcccagtatgcggatcctggtgaacctg
ctcctggacacactgcccatgctggggaacgtgctcctgctctgcttcttcgtcttcttc
atcttcggcatcatcggcgtgcagctctgggcgggtctgctgcgcaaccgctgcttcctg
gaggagaacttcaccatacaaggggatgtggccttgcccccctactaccagccagaggag
gacgacgagatgcctttcatctgctccctttcgggggacaatggcatcatgggctgccac
gagatccctccactcaaggaacagggccgcgagtgctgcctgtccaaggatgatgtctac
gacttcggggccgggcgccaggacctcaacgccagcgggctctgtgtcaactggaaccgc
tactacaacgtgtgccgcacgggcagtgccaatcctcacaaaggcgccatcaacttcgac
aacattggctatgcctggattgtcatcttccaggtgatcaccctggaaggctgggtggag
atcatgtactacgtgatggacgcgcactccttctacaacttcatctacttcatcctgctg
atcatagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccagttc
tcggagaccaagcagcgggagcaccggctgatgctggagcagcggcagcgctacctgtcg
tccagcacggtggccagctacgcggagccgggcgactgctacgaggaaatcttccagtac
gtctgccacatcctgcgcaaggccaagcgccgcacccttggcctctaccagaccctgcag
agccagcgccaggccctgggcccggggggccccacctccgccaagcccgggccccacgcc
aaggagcccaggcacttcaagccctgcccgagacacaacccactggacccagcaccccac
acactggtgcagcccatctctgccatgctggcctctgaccccagcagctgcccccactgc
cagcacaaagtgggccaccggccctcgggcctgggcagcaccgactcgggccaggaaggc
tcgggctcgggctcggggggctccggtggcggagagggtgaggccggcggggatggggcc
cgcagcagcgaagacggggcctcctcggggctggagaaagatgaggaggagcaggcggac
ggggccgcccggctgtgcggggacctgtggagggagacgcgggcaaagctgcgaggcatc
gtggacagcaagtacttcaaccggggcatcatgatggccatcctcgtcaacactgtcagc
atgggcattgagcaccacgagcagcccgaggagctgaccaacgtcctggagatctgcaac
gtggtcttcaccagcatgtttgccctggagatgctcctgaagctggccgcctttgggctc
ttcgactacctgcgcaacccctacaacatcttcgacagcatcatcgtcatcatcagcatc
tgggagattgtggggcaggctgatggcgggctgtcggtgctgcggaccttccggctgctg
cgggtgctgaagctggtgcgcttcatgcccgcactgcggcgccagctggtggtgctcatg
aagaccatggacaacgtggccaccttctgcatgctgctcatgctgttcatcttcatcttc
agcattctcgggatgcacatctttggctgcaaattcagcctccgcacagactcgggagat
acgatccccgacagaaagaacttcgactccctgctgtgggccatcgtcacggtgttccag
atcctcacccaggaggactggaacgttgtcctctacaatggcatggcctctacctccccc
tgggcctccctctactttgttgccctcatgaccttcggcaactatgtgctcttcaacctg
ctggtggccatcctggtggaaggcttccaggcggagggtgatgccaatcgctcctactcg
gaggaggaccagagtttatccaacgcggaggagtttgagaagctccaagagggcctggac
agcggtggagatcccaagctctacccaattcctctgacccccaatgggcacctggacctc
agtcttcccctgggtggacatctgggccccactgggactgtggcacctgcccgcctgtcg
ctgcagccggaccctatgctggtggccctgggctcccgcaagagcagtgtcatgtcactg
gggagggtgagctacgaccagcgctccctgtccagcacccggagctcctactatgggccg
tggggccgcagcggggcctgggccagccgccgctccagctggaacagcctcaagcacaag
ccaccgtgtgcagagcacgagtccctgctctccgcggagcgcagtggtggcagcggtggc
ggggccagggcctgcgagggcgctggggacgaagggccaccacgggctgtgcccctgcac
atccagcacgcccaccacgcacatcatggtccccacccgatgcaccggcaccaccaccac
cgccggacactgtccctcgacaccagagactcggtggacctggctgagctggggcccgcg
gtgggtccccacccccgggcggcctggaggacagtgggcatggtccccgggcacgaggac
tgcaatggcaggatgcccagcatcgccaaggaggtcttcaccgagatgggcgaccgccag
gacgacggggacgacgagggggaggtggactacactctgtgtttccgggtgcgcaagatg
attgacgtctacaagcctgactggtgcgaggtccgcgagaactggtctgtctacctcttc
tcccccgagaacaggttccgcgtcctgtgccagaccatcattgcccacaaactctttgac
tatgtcgtcctggccttcatttttctcaactgcatcaccatcgccctggagcggccccag
attgaggctggcagcaccgaacgcatattcctcaccgtgtccaactacatcttcacagcc
atcttcgtgggcgagatgacattaaaggtggtctctctgggtctgtacttcggggagcag
gcgtacctgcgcagcagctggaacgtgctggatggctttctagtcttcgtgtccatcatt
gacatcgtggtttccctggcttccgccggcggagccaagatcttgggggtcctccgggtc
ctgcggctcttgcgcaccctacgacccctgcgtgtcatcagtcgggcgcctggcctgaag
ctggtggtagagacgctcatctcctccctgaagcccattggcaacattgtcctcatctgc
tgtgccttcttcatcatcttcggcatcttgggggtgcagctcttcaagggcaagttctac
cactgtctgggtgtagacacccgaaacatcaccaaccgttctgactgcatggccgccaac
taccgctgggtccatcataagtacaacttcgacaacctgggccaggccctgatgtccctc
tttgtcttggcctccaaggatggctgggtgaacatcatgtacaatggactggatgctgtc
gctgtggaccagcagcccgtgcccaaccacaacccctggatgctgctctacttcatctcc
ttcctgctcatcgtcagcttcttcgtgctcaacatgttcgtgggcgtggtggtggagaac
ttccacaagtgccggcagcaccaggaggccgaggaggcccggcggcgcgaggagaagcgg
ctgcggcgcctggagaagaagcgccgcaaggcccagcggctgccctactatgccacttac
tgtcccacccggctgctcatccactccatgtgcaccagccactacctggacatcttcatc
accttcatcatctgcctcaatgtggtcaccatgtccctggagcactacaaccagccaacg
tccctggagacagccctcaagtactgcaactacttgttcaccactgtctttgtgctggag
gctgtgctgaagctggtggcatttggtctgaggcgcttcttcaaggacaggtggaaccag
ctggacctggcgatcgtgctgctctcggtcatgggcatcacgctggaggagatcgagatc
aacgcggcactgcccatcaaccccaccatcattcgcatcatgagggttctgcgcatcgcc
cgggtgctgaagctgctgaagatggccacgggaatgcgggccctgctggacaccgtggtg
caagccctgccccaggtgggcaacctgggcctcctcttcatgctgctcttcttcatctac
gccgccctgggagtggagctctttgggaagctggtctgcaacgatgagaacccgtgtgag
ggcatgagccggcatgccacctttgagaacttcggcatggccttcctcacgctcttccag
gtctccactggcgacaactggaacgggatcatgaaggacacactgagggactgcacccat
gacgagcgcagctgcctgagcagcctgcagttcgtgtcgccgctctacttcgtcagcttt
gtgctcacggcgcagtttgtgctcatcaacgtggtggtggctgtgctcatgaagcacctg
gacgacagcaacaaggaggcccaagaggacgctgagatggatgccgagctcgagctcgag
atggcccagggcctcggtcccggcccacggctgcccaccggctccccgggggtgcctggc
cgagggccaggcgggccaggcggcgggggtgacccagaaggccgcctgtgcccacactgc
tactctccagcccaggagaacctgtggctggacagcgtctctttaatcatcaaggactcc
ttggatggggagctgaccatcatcgacaacctgtctggctccatcttccaccactattcc
tcgccggccggctgcaggaagtgccaccacgacaagcaggaggtgcagctcgctgagaca
gaagccttctccctgaactcagacaggtcctcatccatcctgctgggtgatgacctgagt
ctcgaggacctcacggcctgcccacttcgccctaaagacagcaagggtgagtcagaccca
cctgagcccgtgcgtgtgggggatctgggtgagtgcttcttccccttgtccaacacagcc
gtatccttggggcctgagaacttcctgtgcgagatggaggcagtctccttcaaccccgtc
cgatcctggctgaaacatgagagcagccaagcaccttcgagccccttctccccagaggca
tccagcccactcctgcccatgccagcggagttcttccaccctgctgtgtcctccagccag
aaagggcaggagaagggtgctggtgctgggaccctccccaagattgccctgcagggctcc
tgggcatccctgcggtcaccgagtgtcaactgcaccctcctccggcaggccacagggagc
gacacttcgctggaggccagccgcagcagctcagcgggcagcctgcagaccacactggag
gacagcctgaccctgagtgacagtccccggcgcgccctg

DBGET integrated database retrieval system