KEGG   Miniopterus natalensis: 107531684Help
Entry
107531684         CDS       T05883                                 

Gene name
CMA1
Definition
(RefSeq) LOW QUALITY PROTEIN: chymase
  KO
K01329  chymase [EC:3.4.21.39]
Organism
mna  Miniopterus natalensis
Pathway
mna04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    107531684 (CMA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mna01002]
    107531684 (CMA1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     107531684 (CMA1)
Peptidases [BR:mna01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107531684 (CMA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Peptidase_S29
Motif
Other DBs
NCBI-GeneID: 107531684
NCBI-ProteinID: XP_016061274
Position
Unknown
AA seq 250 aa AA seqDB search
MGSLSEKMGHLPLPLLFFLLCSRSEADESEGEIIRNTECKPHSCSYMAHLEIVTPQNKVV
YCGGFLIRRNFVLTAAHCAGRRIMVTLGAHNITKKEDTWQKLEVTKQFPHPKFDYSLAHH
LNEKANLTLAVGTFPLXVQFNFDPPGRMCRVAGWGIIEVEKSGSNTLQEVKLRLMDPQAC
RHFRTFDHSLQLCMGNPKKTKSAFKGDSGGPLLCSGVAEGIVSYGQEKLPFVLTWISHYQ
PWINKVLKEN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcctctctgagaaaatgggtcatcttcctctccccctgctgttcttccttcta
tgctccagatctgaagctgatgagtctgagggggagattatcaggaacacagaatgcaag
cctcactcctgctcctacatggcccacctggaaattgtcactccccagaataaagtggtg
tactgtggtggtttcctgataagacggaactttgtgctgacggctgctcactgtgcagga
aggcgtataatggttacccttggagcccataacataacaaagaaagaagacacatggcag
aagcttgaggtcacaaaacaattccctcatccaaaatttgattacagtcttgctcatcat
ttgaatgagaaagccaacctgaccctggcggtggggacattcccccttnctgtccagttc
aatttcgacccacctgggagaatgtgccgagtggctggctggggaataatagaagtggag
aaatcaggctccaacactctgcaagaggtgaagctgagactcatggatccccaggcctgc
agacacttcagaacttttgaccacagtctccagctgtgcatgggcaatcccaaaaagaca
aaatctgcatttaagggagactcaggtggccctcttctgtgttctggggtggccgagggc
attgtctcctatggacaagagaagctcccttttgtcttaacctggatctcccattaccag
ccctggatcaataaggtcctgaaggagaactga

DBGET integrated database retrieval system