KEGG   Miniopterus natalensis: 107531740
Entry
107531740         CDS       T05883                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna01522  Endocrine resistance
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04072  Phospholipase D signaling pathway
mna04114  Oocyte meiosis
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04727  GABAergic synapse
mna04742  Taste transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04972  Pancreatic secretion
mna04976  Bile secretion
mna05032  Morphine addiction
mna05163  Human cytomegalovirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107531740 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107531740 (ADCY4)
   04371 Apelin signaling pathway
    107531740 (ADCY4)
   04020 Calcium signaling pathway
    107531740 (ADCY4)
   04072 Phospholipase D signaling pathway
    107531740 (ADCY4)
   04024 cAMP signaling pathway
    107531740 (ADCY4)
   04022 cGMP-PKG signaling pathway
    107531740 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107531740 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107531740 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107531740 (ADCY4)
   04062 Chemokine signaling pathway
    107531740 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    107531740 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    107531740 (ADCY4)
   04912 GnRH signaling pathway
    107531740 (ADCY4)
   04913 Ovarian steroidogenesis
    107531740 (ADCY4)
   04915 Estrogen signaling pathway
    107531740 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    107531740 (ADCY4)
   04921 Oxytocin signaling pathway
    107531740 (ADCY4)
   04926 Relaxin signaling pathway
    107531740 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    107531740 (ADCY4)
   04918 Thyroid hormone synthesis
    107531740 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    107531740 (ADCY4)
   04916 Melanogenesis
    107531740 (ADCY4)
   04925 Aldosterone synthesis and secretion
    107531740 (ADCY4)
   04927 Cortisol synthesis and secretion
    107531740 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107531740 (ADCY4)
   04270 Vascular smooth muscle contraction
    107531740 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    107531740 (ADCY4)
   04971 Gastric acid secretion
    107531740 (ADCY4)
   04972 Pancreatic secretion
    107531740 (ADCY4)
   04976 Bile secretion
    107531740 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    107531740 (ADCY4)
   04727 GABAergic synapse
    107531740 (ADCY4)
   04725 Cholinergic synapse
    107531740 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    107531740 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    107531740 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    107531740 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    107531740 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    107531740 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107531740 (ADCY4)
   04714 Thermogenesis
    107531740 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107531740 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    107531740 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    107531740 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107531740 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107531740 (ADCY4)
   05163 Human cytomegalovirus infection
    107531740 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107531740 (ADCY4)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107531740 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 107531740
NCBI-ProteinID: XP_016061373
Position
Unknown
AA seq 1076 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALLALLTVAWASGRELASDPG
FLTTVLCALGGFSLLLGLASCEQRLQRWTRPLSGLVWAALLALGHGFLFTGGVVSAWDQV
SFFLFVIFTTYAMLPLGMREATAAGLASSLSHLLVLGLYLGPQLDSRPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAQEMK
AEIMARLQSGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAAVEHRDPYLRELGEPTYLVIDPRAEEEEEKGTAGELLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKALASSSPQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLLLFVCFSEHLTMCVLKGPKMLHWLPTLSGLVATRP
GLRVALGTATILLIFTMAITSLFLPATSNCHFQAFNVSSMNFNLSWELPGSLPLISIPYS
MHCCVLGFLSCSLFLHMSFELKLLLLLLWLVASCCLFLHSHAWLSDCLVARLYLGSLDSR
PGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETEMMENLTRLL
LENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRL
LNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVE
FAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTG
VLGKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRVGPPSATLG
NT seq 3231 nt   +upstreamnt  +downstreamnt
atggcccgactcttcagtccccggccgccgcccagcgaagacctcttctatgagacctac
tatagcctgagccagcagtacccactcctgctcctgctcctggtgatcgtgctctgcgcg
ctcctggcgctgcttactgtcgcctgggccagcggcagggagctggcctcagacccgggc
ttcctgaccacagtgctgtgtgcgctcggaggcttctccctgctgctgggcctggcttcc
tgcgagcagcgactgcagcgctggacgcgccccctctcaggcctcgtgtgggcagcgctg
ctggcactaggccatggcttcctgttcaccgggggtgtggtgagcgcctgggaccaggtg
tcctttttcctctttgtcatcttcactacgtatgccatgttgcccttgggcatgcgggag
gccaccgctgcaggccttgcctcctcactctcacacctgctggtcctcgggctgtatctt
ggacctcaactggactcaagacccgcactgctgccgcagttggcagcaaacgcggtgtta
ttcctgtgcgggaatgtggctggagcataccacaaggcgctgatggagcgcgcactgcgc
gccaccttccgagaggcacttagttccctgcactcgcgccggcggctggacacagagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacttggcccaagagatgaag
gcagagatcatggcacggctgcagtctggacaggggtcaaggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatagtg
ggcttcacacggctggccagtgagtgctccccaaaagagttggtgctcatgctcaatgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctccgggctgcccctctccctaccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactacgagcggccaccggt
gtggatatcaacatgcgcgtgggtgtgcactcgggcagcgtgctctgtggggtcatcgga
ctgcagaagtggcagtatgatgtctggtctcacgacgtcacactggccaaccacatggag
gcgggtggcgtgccaggacgagtgcatatcacaggggctaccctggccctgctggcagga
gcttacgccgtggaggatgcggccgtggagcaccgggacccatacctccgggagctaggg
gagcctacatacctggtcatcgacccccgggcagaggaggaggaggaaaagggcactgca
ggagagctgctgtcctctctcgagggtcccaagatgcgtccatcactgctgatgacccgc
tacctggaatcctggggtgcagccaagccttttgcccacctgagccacgtagagagccct
gtgtccacctccactcctctcccggagaaggccctggcttcctccagcccccagtggagc
ctggaccggagccgtacaccccggggactagatgatgaactggacactggggatgccaag
ttcttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtcaaaggacttc
aacccactgaccctgtactttcgagagaaggaaatggagaaagagtatcgactctctgca
ctccccgccttcaaatactacgcagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctggtgacaaacaggcccccagctctggccatcacctatagcatcaccttc
ctcctcttcctcctcctcctcttcgtctgcttctcagagcacctgacgatgtgtgtcttg
aaaggccctaagatgctgcactggctgcccacactgtctggcctggtggccacacggccc
ggactgcgagttgccctgggcactgccaccatcctcctcatctttaccatggccattacc
agcctgttcttaccagcaacatcgaactgccattttcaggctttcaatgtgtcctccatg
aatttcaacctctcctgggagctccctgggtccctgcctctcatcagcattccatactcc
atgcactgctgcgtgctgggtttcctctcctgctccctttttctgcacatgagcttcgaa
ctgaagctgctgctgctcctgctatggctggtggcctcctgctgcctcttcctgcactcc
cacgcctggctgtccgactgcctggtcgcccgcctctatctgggctccttggactccagg
ccaggggtgctgaaggaacccaaactgatgggagccatctccttcttcatcttcttcttc
acactccttgtcttggctcggcagaatgagtattattgccgcctggatttcctgtggaag
aagaagctgaggcaggagcgggaggagacagagatgatggagaatctgactcggctgctc
ttggagaatgtgctccctgcacatgtggccccccagtttattggccagaaccggcgcaat
gaggacctctatcaccagtcctacgagtgtgtttgtgtcctcttcgcctcagtcccagac
ttcaaagagttttactctgaatccaacatcaaccatgaggggctagagtgtctgcggctg
ctcaatgagatcattgctgattttgatgagctgctttctaagcccaagttcagtggggtg
gagaagatcaaaaccatcggcagcacctacatggcagctacaggtttaaatgccacctct
ggacaagatgcacagcaggatgctgagcgaagctgcagccaccttggcaccatggtggaa
tttgcagtggcccttgggtctaagttggacgttatcaacaagcactcattcaacaacttc
cgcttgcgtgtggggttgaaccacggacctgtagtggccggagtgataggggcccagaaa
ccacaatatgacatctggggcaacacagtgaatgtcgccagtcgcatggagagtacagga
gtcctgggcaagatccaagtgactgaggagacagcccgggccctgcagtccttaggctac
acctgctacagcagaggtgttatcaaggtcaaaggcaaagggcagctatgcacctacttc
ctgaacacagatttgacacgagttggacctccctcagctaccctaggctga

DBGET integrated database retrieval system