KEGG   Miniopterus natalensis: 107532311
Entry
107532311         CDS       T05883                                 

Definition
(RefSeq) aminopeptidase O
  KO
K09606  aminopeptidase O [EC:3.4.11.-]
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107532311
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     107532311
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M1
   107532311
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 107532311
NCBI-ProteinID: XP_016062133
Position
Unknown
AA seq 772 aa
MDIKLDPSRDDLPLMANTSHILVKHYVLDLDVDFESQIIEGTLVLFFESGNRYRKKSGST
EETCQSESNEACKFRTPEPCLVPVTNTRTFSSKMGYSDFAICDEGERDTSGKDGNHDDQE
QASGISSWKQCCDTGNHGSEDFLLVLDCCDLSVLKVEEVDVAAVPGIEKFTRSPKLTVVS
ELRNQIVRELVTLPADRWREQLDYYARCSQAPGCGELLFDIDTWSLQIRKTGAQTATDFP
HAIRIWYRTKPQGRSVTWTSDQSGRPCVYTMGSPVNNRALFPCQEPPVAMSTWQATVRAA
ASFVVLMSGENSAKPTQLREGCSSWHYYVTMPMPASTFTIAVGPWMEVKPETCSLNALAA
ERSLSPSEADSRCVGICGHMEYPCRFQNASATTQEIIPHRVFAPVCLEGACQETLLQLVS
PCLAAAHSVLGTHPFSRLDILIVPANFPSLGMASPHIVFLSQSAVTGGSHLCGTRLCHEI
AHAWFGLAIGARDWTEEWLSEGFATHLEDVFWARAQQLAPHEAQELQELRACLHWRRLQD
EVRNSPEQLQVLRPNKEKTGHVSDSGSSVIKHGLNPEKVFMQVHYLKGYFLLRLFARRLG
HDAYFSFLRKFVHTFHGQLILSQDFLQMLLENIPEEKRLDLSVESICRDWLESPGLPQLL
PDQLVLLLEHLLEQKTLNPRTLQSLERTYHLPQQDAEVRHRWCELIVKHKYTKAYKNVEK
FLQEDQAMGIYLYGELMVSEDTRQQQLARSCFELTKEQMDRCSAQVVAEMLF
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggacataaagctggacccttctcgagatgacctgcctctcatggccaacaccagccac
atacttgtgaagcactatgtactggatttagatgtggatttcgaaagtcaaatcattgag
ggcaccttagtacttttctttgagtctggaaacagatacaggaaaaagagtggttccact
gaggaaacctgccaatcagagtcaaatgaagcctgcaaatttaggacgccggaaccctgc
cttgttcctgtgacaaatacaaggaccttctcatctaaaatgggatacagtgattttgca
atctgtgatgaaggtgaaagagatacttctggtaaagatggtaaccatgacgaccaggaa
caggcttctgggatttctagctggaagcagtgctgtgacacagggaatcatgggagcgag
gatttcttgctggtgttggactgctgtgatttatctgtgttaaaggttgaggaggtggat
gttgctgctgtgccaggtattgaaaaatttacaaggtctcccaagctcacggttgtttct
gagctcaggaatcagattgtacgtgaacttgtgactctgcctgcggatcggtggagggag
cagttagactattacgctcgctgcagccaggctcctggctgtggggaactcctgtttgac
attgacacttggagcttacagatcaggaagacaggggctcagacagctactgactttcct
cacgccataaggatatggtacagaaccaaaccccaggggcgatcagttacatggacctca
gaccagagtggcaggccatgtgtttatactatgggatctccagtaaacaacagggccctt
tttccatgccaggagccacccgttgccatgtcaacatggcaggccacagtccgagcagct
gcatcttttgttgttttaatgagtggggaaaattctgccaagccaacacagcttcgggaa
gggtgctcaagctggcattactacgtaaccatgccaatgccagcctccaccttcacaatt
gcagtgggaccctggatggaagtgaagccagagacctgctcactaaatgctctggcagca
gagaggtccctctcaccttccgaggctgactctaggtgtgttggcatttgtggccacatg
gaatacccctgccgctttcagaatgcttctgccaccacccaggagatcattcctcatcgg
gtcttcgccccagtttgcctcgaaggtgcctgccaagagacccttctgcagctggtctct
ccttgcctcgcagcagcacactctgtcctggggacccacccattttccaggctggacata
ctcatcgttcctgccaactttccaagtctggggatggccagcccacacatcgtcttcctc
tcgcagagcgccgtgaccggaggcagccatctctgcgggacccgcctctgccatgaaatc
gctcacgcctggtttggccttgccatcggcgcccgtgactggacggaggagtggctgagc
gaagggtttgccactcacttggaagatgtattctgggccagagcccagcagctggccccc
cacgaggcccaggaactgcaggagctgcgggcttgcctgcactggcggcgcctccaggac
gaggtgcggaactccccggagcagctgcaggtgttgagacccaataaagagaaaactggc
catgtgagtgactcaggatcatctgtcatcaaacatgggctcaatccagagaaggtcttc
atgcaggttcattatttaaagggctatttccttctccggctctttgccagaagacttgga
cacgatgcctatttttcatttttaaggaaatttgtgcacacgtttcacgggcagttgatt
ctttcccaggatttccttcaaatgctgttggagaacatcccagaagaaaaaaggcttgat
ttgtctgtcgaaagcatctgccgagactggcttgagagtcccggactcccacagctcctt
ccagaccagctggtcctgcttctggagcatctgttggagcagaagaccctgaaccctaga
actctgcaaagcctcgaaaggacataccacctcccccagcaggatgcagaggttcgccat
cggtggtgtgagctcattgttaagcacaaatacacaaaagcgtacaaaaacgtggagaag
ttccttcaggaggatcaggccatgggcatctacctctacggggagctgatggtgagtgag
gacaccaggcagcagcagctcgcccggagctgcttcgagctgaccaaggagcagatggat
agatgctcagcccaggtggtggccgagatgttgttttaa

DBGET integrated database retrieval system