KEGG   Miniopterus natalensis: 107532496
Entry
107532496         CDS       T05883                                 

Gene name
ENPEP
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
mna  Miniopterus natalensis
Pathway
mna04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    107532496 (ENPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107532496 (ENPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107532496 (ENPEP)
   04090 CD molecules [BR:mna04090]
    107532496 (ENPEP)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     107532496 (ENPEP)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M1
   107532496 (ENPEP)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107532496 (ENPEP)
CD molecules [BR:mna04090]
 Proteins
  107532496 (ENPEP)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Cyclophil_like Cucumo_coat DUF1570
Other DBs
NCBI-GeneID: 107532496
NCBI-ProteinID: XP_016062365
Position
Unknown
AA seq 944 aa
MNFAEGDGSKRYCIRGKHVAIICAAVAAVGLIVGLSVGLTRSCGLPEGAPSEAPPRGPPT
ASPLPCPPSDDDSGAWRNFRLPDFITPVHYDLQVKPEMDRDTYTGTVSIAINLTAPTRHL
WLHLRETRVSAPPLLARPSGAPVXVRRCFQYRPREFVVLEAAEELPPGGAAGLYRLSLDF
AGRLNGSLVGFYRTTYVEKGQVKSIAATDHEPTDARKSFPCFDEPNKKATYTISIIHTKD
YKALSNMPVEKEEPVDDKWIRTTFQKSVPMSTYLVCFAVHQFHPIERKSKRGIPLTVYVQ
PEQKHTGEYAANITQSVFDYYEEYFAMEYALPKLDKIAIPDFGTGAMENWGLITYRETNL
LYDPQESASSNQQRVATVVAHELVHQWFGNTVTMDWWEDLWLNEGFASFFEFLGVNHAEK
NWQMRDQMLLEDVLPVQEDDSLMSSHPIVVTVTNPDEITSAFDGISYSKGASILRMIEDW
ITPQKFQRGCQIYLEKYKFKNAKTSDFWAALEEASNLPVKEVMDTWTKQMGYPVLDVKDR
TVKQKRFLLDPRANPSLPHSDLGYTWNIPVKWSEDNVSNVSFYNRTETGGITLNSPKPGG
NGFLKINPDHIGFYRVNYEVPTWELIATNLSSNRESFSSADRASLIDDAFALARAKLLDY
KVALNLTKYLNTENDFLPWQRVISAVTYIISMFEDDKELYPVIEEYFRGQVKPVADSLSW
NDSGDHLTKLLRASVLGFACKMGDSEALGNASQLFQLWLTGNVRIPVNLRLLVYRYGMQN
SGNETSWNYTLSQYQKTSLAQEKEKLLYALASVKNITLLSRYLDLLKDSNLIKSQDVFTV
IRYISYNSYGKSMAWNWIQLNWEYLVNRFTLNDRSLGRIVTIAEPFNTELQLWQMESFFK
RYPEAGAGEKPREQVLETVKNNIEWLKQNRESIREWFLGLRRNG
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgaactttgcggagggagacggctctaagagatactgcattcgagggaagcacgtggcc
atcatctgcgcggcggtggcggccgtagggttgatagtggggctgtcggtgggcttgacc
cggtcgtgcggcctccccgaaggggccccttccgaggcgcccccncgaggcccccccacc
gcgagccctctgccctgcccccccagcgacgatgacagcggagcctggaggaacttcagg
ctgccggacttcatcacgcccgtgcactacgacctgcaggtgaagcccgagatggaccgg
gacacctacaccggcacggtgagcatcgccatcaacctgacggcgcccacgcggcacctg
tggctgcacctgcgggagaccagggtgagcgcgccgccgctgctcgcgcggccgtcgggg
gcgccggtgngcgtgcgccgctgcttccagtaccgcccgcgcgagttcgtggtgctggag
gcggcggaggagctgccgcccggcggcgccgcggggctctaccgcctgagcctggacttc
gccggccgcctcaacggctcgctcgtgggcttctacaggaccacctacgtggagaaaggc
caagtcaagagcatagcagccactgatcatgaaccaacagatgccaggaaatccttccct
tgttttgatgagcccaacaaaaaggcaacttatacgatatctatcatccacaccaaagac
tataaggcactttcaaatatgccagtggagaaagaagagccggtggatgataaatggatt
cgaacaacgttccagaagtctgtccccatgagcacttacctggtgtgctttgctgtgcat
caatttcatcccatagagagaaagtcaaagaggggaatacctcttactgtgtatgtccag
ccagagcaaaagcacacaggtgaatatgctgccaacataactcaaagtgtgtttgattat
tatgaagaatacttcgctatggagtacgcgcttcctaaattagataagatcgctattcca
gactttggcaccggagctatggagaactgggggctcatcacgtacagagaaacaaacctg
ctctatgacccccaggaatcagcctcatcaaaccagcagagggtggccacagtggttgcc
cacgaacttgtgcatcagtggtttggaaacactgtgaccatggactggtgggaagacttg
tggctaaatgaaggcttcgcttccttctttgagttcctgggagtaaaccatgcagaaaaa
aattggcaaatgcgggaccagatgttgcttgaagatgtgcttcctgtacaagaggatgat
tctttgatgtcttcacacccaattgttgtcaccgtgaccaatcctgatgaaataacatct
gcctttgatggaatatcctacagcaagggagcttccattctgaggatgattgaagactgg
ataacaccacagaaatttcaaagaggatgtcagatttacttggaaaaatacaaatttaag
aatgcaaaaacttcagatttttgggcagcacttgaagaggcaagtaatctaccagtgaaa
gaagtaatggacacctggaccaaacagatgggctatcctgtccttgatgtgaaagacagg
accgtcaaacagaaacgctttctgttggacccaagagctaatccttctctgccacattca
gaccttggttacacatggaatattccagttaaatggagtgaagataatgtgtccaatgtt
tcattctacaacaggacagaaacaggaggaataactttgaactctcctaagcctggtgga
aatggttttctcaaaataaacccagatcacattgggttttatcgtgtaaattatgaagta
ccaacttgggaactgatcgctaccaatctttcctccaaccgtgagagtttttcttctgct
gatcgtgcaagtcttattgatgatgcttttgccttggcaagagctaaacttctagattat
aaagtggctctgaacttgaccaagtatctcaatacggaaaatgactttttaccatggcag
agagtcatttcagctgtaacctatatcattagcatgtttgaagatgataaagagctatac
cctgtgattgaggagtacttccgaggtcaagtgaagccggttgcagactctctgtcatgg
aatgattctggagaccacctcacaaagttactccgtgcctctgtgttggggtttgcctgc
aagatgggagacagcgaagccttgggcaatgcttcccagttatttcagctgtggctcacc
gggaacgtaaggattcctgtaaatctcagacttctggtgtatcggtatggaatgcagaat
tctggcaatgagacttcatggaactacactcttagtcaatatcagaaaacttcattagct
caagaaaaagaaaagctgctgtacgcattagcctcagtcaagaatattactcttttgtca
aggtatttggatttgctcaaggactcaaaccttattaaaagtcaggatgtgtttacggtc
atccgatatatctcatataacagctatgggaagagcatggcttggaactggatacagctc
aactgggaatatctagtcaacagattcacactcaatgacagaagccttggccggattgtc
acgatagcggagccattcaacactgaactccagctctggcagatggagagttttttcaaa
agatacccagaagctggagcaggagaaaaaccgagggagcaagtgctggaaaccgtgaaa
aacaatattgaatggctaaagcaaaatagagagagcataagagaatggtttttgggatta
cgtcggaatggttaa

DBGET integrated database retrieval system