KEGG   Miniopterus natalensis: 107532650
Entry
107532650         CDS       T05883                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00240  Pyrimidine metabolism
mna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107532650 (DCK)
   00240 Pyrimidine metabolism
    107532650 (DCK)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     107532650 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_17
Other DBs
NCBI-GeneID: 107532650
NCBI-ProteinID: XP_016062576
Position
Unknown
AA seq 281 aa
MEPPYYIWFNIDRNIIMLCTTINFEKLKTILAFKKIFWYVFILSFTFPLTIAAGKSTFVN
ILKQVCEDWEVVPEPVARWCNVQSNQDEFQGLTTSQKSGGNVLQMMYEKPERWSFTFQSY
ACLSRVRAQLAALDGKLKDVERPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWH
DWMNNQFGQSLELDGIIYLQASPEKCLSRIYLRGRKEEQGIPLEYLEKLHYKHESWLLHR
TLKTNFDYLQEVPILTLDVNEDFKDKHDSLVEKVKEFLSTL
NT seq 846 nt   +upstreamnt  +downstreamnt
atggaaccaccatattatatatggttcaacattgaccgaaatatcattatgctgtgcacg
actataaattttgaaaagctgaagacaattttggcttttaaaaaaattttctggtacgtt
ttcatcctcagttttacttttcctctcacaatagctgcagggaagtcaacatttgtgaat
atccttaaacaagtctgcgaggactgggaagtggttcctgaacctgttgccagatggtgc
aatgttcaaagtaatcaagatgaatttcagggactgacaacatctcagaaaagtggtggg
aatgttcttcagatgatgtatgagaagcccgagcgatggtctttcaccttccagtcgtac
gcctgcctcagtcgtgtacgagctcagctcgccgctctcgatggcaagctcaaggatgtg
gagagacctgtgctattttttgaacgctctgtgtatagcgacaggtatatttttgcatct
aatttgtatgaatctgaatgtatgaatgaaacagagtggacaatttatcaagactggcac
gactggatgaataaccagtttggccaaagccttgaactggatggaatcatttatcttcaa
gccagtccagagaaatgcttgagtagaatatatttacggggaagaaaagaagaacaaggc
attcctcttgaatatttggagaagcttcactataagcatgaaagctggctcctgcatagg
acgctgaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaat
gaagactttaaagataaacacgacagcctggttgaaaaggtcaaagaatttttgagcact
ttgtga

DBGET integrated database retrieval system